KEGG   Methanocorpusculum labreanum: Mlab_0050Help
Entry
Mlab_0050         CDS       T00472                                 

Definition
aminotransferase class-III
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_0050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_0050
   00020 Citrate cycle (TCA cycle)
    Mlab_0050
   00620 Pyruvate metabolism
    Mlab_0050
   00640 Propanoate metabolism
    Mlab_0050
   00650 Butanoate metabolism
    Mlab_0050
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_0050
   00680 Methane metabolism
    Mlab_0050
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_0050
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(51405..52295)
Genome map
AA seq 296 aa AA seqDB search
MTEIPKEEMLLKCPSTCAGCGSLLALRYILKAAGKDTVLVIPACCNSVIQGVYPYMLHTV
PVYNIAFAAAAACASGMSEALRAKGEKTNVIVYAGDGGTADIGIQALSGALERGEDFLYI
CYDNEAYGNTGMQRSGATPLGAITTTTPNGKTVNKKDLDRIVEAHNLPYQATACSSYPAD
IYNKVKKALSIPGPKFIHILAPCPPGWRIPSEKTVEIGKMAVKSGIWVLWEKEYDKFTVS
APSRAAMKRPAPVSDYLKAQGRFRKVDEKTAAVIQANVDKNLKKIALEAAQSEETE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaattcccaaagaagagatgcttttaaagtgtccatccacctgtgctggatgc
ggctcgttacttgcactccgctatatcctcaaggctgcaggcaaagatacggtcctcgtg
atccctgcctgctgcaacagtgtgatccagggtgtctatccctacatgcttcacacggtg
cccgtctataacatcgcatttgcggccgcagcggcctgtgcttccggtatgagcgaagct
ctccgcgcaaaaggtgaaaaaaccaacgtcatcgtctatgcaggagacggaggcacagcc
gacatcggtatccaggcactgtccggggccctggaacgcggcgaggacttcctctatatc
tgctacgacaacgaagcatacggaaataccggaatgcagagatcaggcgcgaccccgctt
ggagcaataaccactactaccccgaacggaaaaaccgtcaacaagaaagatcttgacagg
atcgtcgaggcccataaccttccctaccaggcaacggcctgctcctcgtaccccgccgac
atctacaacaaagtgaaaaaagccctttcgatcccgggaccgaagttcatccacatcctt
gcaccctgcccgccgggctggaggatcccctcggaaaagaccgtcgagatcggaaagatg
gcagttaaatccggcatctgggtcctctgggaaaaagagtacgacaaattcacggtgagt
gccccatcacgtgccgccatgaaacggccggcacccgtaagtgactacctcaaagcccag
ggacgattcagaaaagtcgatgaaaaaacagccgcagtcatccaggcaaacgtcgacaaa
aacctgaagaaaattgctctcgaagccgcacaatcggaggaaacagaatga

DBGET integrated database retrieval system