KEGG   Methanocorpusculum labreanum: Mlab_0051Help
Entry
Mlab_0051         CDS       T00472                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mla  Methanocorpusculum labreanum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mla00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(52454..53341)
Genome map
AA seq 295 aa AA seqDB search
MLRNVLSKNEGVSPVIGTILLVALTVVLVGIIGAVLMGFGMPEPAPIVGISIGSQGNTIT
VTQLNGAVLPAGSYTILVDGVDKTAEFGGDVDFGPGITLSWDSGSEAVGTVSVVYTSDKG
VSTLLAEKKIGKAGGGGGNIKIIEIGGESFNLSNEWGDEWTNIVAQAKNLTYPEASIPIA
PYKVYYDSGNYWWVRNSGLSLTKAEADLDPSLDTFTASHVGELIKIKRDRLLTYDDTEFA
WAGTVKFLNAVKPVNTGTLFTNGPNLYVWAHDDDAEYFGPGYLRAWQWAEIGNKI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaatgttctttcaaaaaacgaaggagtgtcccctgttatcggaacgatattg
ctcgttgctctgacagttgttcttgtcggcattatcggagcggttttgatgggatttggt
atgcccgagccggcgccaatcgttggcatatcgatcggaagtcagggaaataccatcaca
gttacccagctgaacggggccgtgcttccggcagggagctatacgatccttgtcgacggt
gttgacaagacggcagagtttggaggggatgtggattttggtccgggtattacgcttagc
tgggattccggatcggaggcggttggaacggtgtcagtagtttatactagtgataaggga
gtatcaacacttcttgcggaaaagaaaatcggaaaagcgggagggggaggaggaaatatt
aagataattgaaattgggggtgaaagttttaatctttccaatgaatggggcgatgaatgg
acgaatattgtagctcaggcaaaaaatctgacatatccagaagcaagcatacccatagct
ccctataaagtctattacgacagtggaaattactggtgggttcgaaacagcggcctcagt
ttgacaaaagccgaggctgatttagatccatcattagatacatttactgcatcacacgta
ggcgagctaataaaaattaagcgtgaccggcttcttacatacgatgacacggaatttgcg
tgggctggaacggtgaaattcctcaatgccgtcaaaccggtgaacactggaactctgttt
accaatggaccaaacctttacgtttgggcacacgatgatgatgctgagtacttcggtccg
ggatatctcagagcttggcaatgggcagagataggaaataaaatctga

DBGET integrated database retrieval system