KEGG   Methanocorpusculum labreanum: Mlab_0067Help
Entry
Mlab_0067         CDS       T00472                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mla  Methanocorpusculum labreanum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mlab_0067
Enzymes [BR:mla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mlab_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
70267..71784
Genome map
AA seq 505 aa AA seqDB search
MNLILDMIDISTPVILLNDTDARQIGVLEGDRVTITRIKTKHTIAAPVSITKTLTSQGTA
TISLGTNENLAAEKGDEIEIRAAPRPASIAFIRKKMDGGKFTREETATIISDMSSNVLSP
SEITAYITAAYINGLDMDEVEFLTREMVASGEQITFSKKPVVDKHSIGGVPGNKITLLVV
PVIAASGLLIPKTSSRAITGAGGTADLMEALAPVAFSAAEIKTMTEKAGGVIVWGGATNI
APADDMIVTYEYPLKIDARGQMLASIMAKKMAVGSDTCVIDIPIGPGTKIPDEAEGRVLA
NELITLGNRLGIRVECAVTFGGSPIGRNIGVNLEVSEALSLLEGKRGANSLVQKSVAIAG
IALEMTGKTGADSGAEAAYDIIKKGKALKKMLDIIEIQGGDPKVKSTDFPVGEHTFVVPA
ASDGYVVSVKNQALISIARAAGSPVDHGAGLHLHKKPGEYVKRGEPLLTIYAERGWRLTR
AIEEARTSYPVLVEGMLLERISSNR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttattcttgatatgatcgacatctctacacccgttattcttcttaacgacacc
gatgcccgacagataggcgtacttgaaggcgatcgtgtcaccattacccggataaaaaca
aaacataccattgcggctccagtatctatcacaaaaacactcacgagtcagggaactgcc
accatctcccttggaaccaatgaaaatcttgccgcagaaaaaggtgacgaaatagaaatt
cgtgccgctccacgtccggcatcaatcgccttcatccggaaaaaaatggacggaggtaaa
tttacccgggaagaaacggccacaatcatctccgacatgtcatcgaacgttctctccccc
tcagaaatcaccgcctacatcactgccgcctacatcaacggactcgacatggatgaagta
gaattcctcacccgggaaatggttgcctcaggagagcagatcaccttctcgaaaaaaccc
gtcgttgacaaacactcgataggaggcgttcccggaaacaaaatcacactccttgtcgtc
cctgtgatcgccgcatccggtcttctcattccaaaaaccagctcgcgggcaatcaccgga
gcgggaggaacggctgatcttatggaagcccttgctcccgttgccttctcggctgctgaa
atcaaaaccatgaccgaaaaggccggtggcgttatcgtttggggcggtgcaacaaacatc
gcccccgccgacgatatgatcgtcacctatgagtatcctctgaaaatcgatgcacgaggt
cagatgcttgcaagcatcatggcaaagaaaatggcagtcggctccgacacctgtgtcatc
gatattccgatcggtcccggtacaaaaatccccgatgaagcagaaggcagggtacttgcc
aacgaactcatcacccttgggaatcgtctagggatcagagtagaatgcgccgtcaccttc
ggcggctctcccatcggcagaaacatcggcgtcaacctcgaagtctccgaagctctcagc
ctcctcgaaggaaaacggggtgccaactcccttgtccagaaaagcgtcgccattgcagga
atcgcgcttgaaatgaccggtaaaaccggggccgattcgggagcggaagctgcatatgac
atcatcaaaaaaggaaaagccctcaaaaaaatgctcgacatcatcgagatccagggaggt
gaccccaaagtcaaatcgaccgacttccccgttggcgaacacacctttgttgtacctgca
gcttcagacggctacgtggtctccgttaaaaatcaggccctcatcagcattgcccgggca
gccggatccccggtagatcacggcgcaggtctccatctccacaaaaaacccggagaatac
gtcaaacgcggagagccgcttcttaccatctacgccgaacgcggatggcgtcttacccgg
gccatcgaagaagcaagaacctcctaccccgtccttgtggaaggtatgcttctcgaacgc
atctcgagcaaccgatga

DBGET integrated database retrieval system