KEGG   Methanocorpusculum labreanum: Mlab_0075Help
Entry
Mlab_0075         CDS       T00472                                 

Definition
dCTP deaminase (EC:3.5.4.13)
Orthology
K01494  
dCTP deaminase [EC:3.5.4.13]
Organism
mla  Methanocorpusculum labreanum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mlab_0075
Enzymes [BR:mla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.13  dCTP deaminase
     Mlab_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(78999..79430)
Genome map
AA seq 143 aa AA seqDB search
MVLSSSIIRTRLKEGSLGIDPFAEESLQPSSYDLRSAEDITITKGELTLVPTMEFVSLPE
DLCATLWGRSSFGRKGVVLGAGYIDPGFRGNLTLCMANYGPEDIQVTKGMRVVQMLIHTV
EGKVENTYNGNYQDSYGVVKSKI
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggttctttcttcatcaataatcaggacacgccttaaagagggatctcttggaatagat
cctttcgccgaagaatcgctgcagccctcctcatacgatctcagaagcgctgaagatatc
acaataacaaaaggagagttaaccctcgttccaacgatggagttcgtcagcctcccggaa
gatctctgcgcaacactctggggaagatcatcgttcgggagaaaaggcgtcgttcttgga
gccgggtatatcgacccgggatttcgcgggaacctgacattatgtatggcaaattacggg
cctgaagacatccaggtaaccaaaggtatgcgagtcgtacaaatgctcatccacaccgtt
gaaggcaaagtggaaaatacctacaacggaaattatcaggatagttacggcgtagtgaaa
tcaaaaatttaa

DBGET integrated database retrieval system