KEGG   Methanocorpusculum labreanum: Mlab_0187Help
Entry
Mlab_0187         CDS       T00472                                 

Definition
3,4-dihydroxy-2-butanone 4-phosphate synthase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mla  Methanocorpusculum labreanum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_0187
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mlab_0187
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Mlab_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
176043..177818
Genome map
AA seq 591 aa AA seqDB search
MDGYAGNMVYVDLTSGTTAVKPTPPELKKSYIGGRGFGIRLLTDMVDPKIDPLSDKNILV
FAAGPLTGTGIPLGSRYEVSTIAPLTGLAVSANSGGVFGWKLKKAGFDAAVITGKSAKPV
YLLLDNGKAELRDASRLWGKTTGETTDAIVEELKDPSVRVSCIGPSGEKLVLMSCIINEK
TRAAGRGGVGAVMGSKNLKAIAARGDQLIKPADEEQLKTVKERVKNKIQENGIAKGLHDY
GTAVLVNILNENYLLPTRNFQTAHFDGAEKISGETMAQTILKKPKGCYSCIVQCGRVHEF
DGVTGEGPEYEPDWGFGADCGVDDLKIIARANDLCNEYGLDSISVPTTIACLMEMAEKGY
IDHPIRFGDAEGMLKLVEQIAKREGIGDELAEGSFQFATKHGHPELSMSSKKQELPAYDP
RGIQGYGLATATSVRGGDHVYAYMISPEILGAPEKIDPYLIKGKPQWVKTFQDLTAAIDA
TGMCLFTSFALDAEDYADLLSATTGVKIGADELLQVGERIWNLQKLYNVKRGFGRKDDTL
PDRLLHEPLKEGAPAGQVSHVLEMLDEYYALRGWDAEGVPTEAKLKELGLM
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggatggatatgcaggaaatatggtctatgtcgatctcacctccggaacaacggcagtc
aaaccaacgcccccggaactgaaaaagtcgtatattggcggacggggttttggtatcaga
ctccttaccgatatggtcgacccgaagatcgatccgttgagtgataagaacattctcgtc
tttgcggccggaccgttgaccgggaccgggattccccttggaagccggtatgaggtctcg
acgatcgctcccttgaccggacttgccgtgagcgccaacagcgggggcgttttcggctgg
aagctgaaaaaggccgggttcgatgcggccgtcatcaccggaaaatcagcaaaaccggtc
tatctcttgctcgacaacgggaaagccgaactccgcgatgcttcccgcctctggggtaaa
accaccggcgagaccaccgatgccatcgtcgaggagctgaaagatccgagtgttcgtgtg
tcatgtatcggaccttccggtgagaaactcgttttgatgtcgtgtatcatcaatgaaaag
acccgcgccgccggacgtggcggggttggggccgtgatgggctcgaagaatctgaaagcg
atcgcagcccggggtgatcagctgattaagccggcagatgaagaacagctcaaaaccgtt
aaggaacgcgtgaaaaacaagatccaggagaacgggatcgccaaaggtctgcatgattac
ggaacggctgtcctcgtcaacattctgaacgaaaattatcttctgccgacaagaaacttc
cagaccgcccacttcgacggggcggagaagatatccggcgaaacgatggcgcagacgatt
cttaaaaaacccaaaggctgttactcctgtattgtccagtgtggccgggtccatgaattc
gacggagttaccggcgaaggtccggagtatgaaccagattggggatttggtgccgactgc
ggtgtcgatgatctgaaaatcattgccagggcaaacgatctctgtaatgagtatggcctt
gactccatctctgttcctaccacgatcgcctgtttaatggagatggcggagaaagggtat
atcgaccacccgatccggttcggcgatgcagaaggtatgctgaaactcgttgagcagatt
gcaaaacgcgaaggcataggcgacgaacttgccgaaggctccttccagtttgcgaccaaa
cacggacatccggaactctcgatgagttccaaaaagcaggaactgcctgcctacgacccc
cggggaattcaagggtatggtcttgcgaccgccacctcggttcgcgggggtgatcatgtc
tatgcgtacatgatctcgccggagattctcggcgctcccgagaagatcgatccctatctg
atcaaaggcaaaccccagtgggtcaaaaccttccaggatctgaccgctgcgatcgatgca
accggcatgtgcctctttacgtcttttgctcttgacgcagaggattatgccgaccttctc
tcggcaacaaccggcgtgaagatcggtgccgatgagcttctgcaggtcggtgaacggatt
tggaatctccagaagctctataatgtcaagcggggattcggccgtaaagacgacactctg
ccggaccgtctcctgcacgagcctttaaaagaaggtgcgccggctggtcaggtgtcccat
gtgctcgaaatgcttgacgagtattatgctctgaggggctgggatgcggaaggagttcca
accgaagcaaaactcaaagaactgggactgatgtga

DBGET integrated database retrieval system