KEGG   Methanocorpusculum labreanum: Mlab_0314Help
Entry
Mlab_0314         CDS       T00472                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mla  Methanocorpusculum labreanum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mla00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(298463..298999)
Genome map
AA seq 178 aa AA seqDB search
MQPDFPRIGKRLFAEHLVGGNFGNMSVRTDDGYFITKTGSYLDADPEQIVLMPLNGRVTP
GASSEWRVHTAVYNASEHKAIVHAHPPYAVALSLLADAEIETIDSEGHLLAPTIQVVEGP
CGSQQLADVVAKGLSSANIVIAKGHGTFAAGRDLDQAYLYTSLAEHCCKVLHLTKTYR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgactttccccgaatcggcaaacggttgtttgcggaacacttggttggagga
aacttcggcaacatgagtgtaagaaccgatgatggatatttcatcacgaaaaccggatcc
tacctcgacgcggaccccgaacagatcgtccttatgcccctaaacggcagggtcactccc
ggagcatccagcgaatggcgggtgcatactgcagtctacaatgcctcggaacacaaagcg
atcgtccacgcccacccgccgtatgccgtggccctctcgctcctcgccgacgccgaaatc
gagacgatcgacagcgaaggacacctgctcgccccgacaatccaggtcgtcgaaggcccg
tgcggatcacagcagcttgcagatgtagtggcaaaaggcctttcatctgccaacatcgtc
attgccaaaggtcacgggacctttgcagccggccgcgatctggatcaggcttatctttac
acctcgctcgccgaacactgctgcaaagtcctgcatctgacgaaaacctacagataa

DBGET integrated database retrieval system