KEGG   Methanocorpusculum labreanum: Mlab_0396Help
Entry
Mlab_0396         CDS       T00472                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Organism
mla  Methanocorpusculum labreanum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(372850..373509)
Genome map
AA seq 219 aa AA seqDB search
MFTFNTIEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMP
MGRSLVEKLCLPPMVLKNTDNHETAFTVSIDHVDTTTGISAVERGITARKCIDPNARPED
FRRPGHMFPLQAKDNGVFEREGHTEATVDLMKLAGLREAGLCCEIMADNGEMMRTPELIS
MAKQYNLTFVTIKDLQAYRRKQEASALAVEQKNMSPMDC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatttaacacgatcgaagaggccctgaaatcccttcaaaacggagagatgatc
atcgtcaccgatgatgagaaccgagagaacgaaggtgacctgatctgtgccgccgaatat
gccacgacggaaaatgtcaacttcatggcaaaatacggcagagggctgatctgcatgccg
atgggacgcagtctcgtcgaaaaactttgtctcccgccgatggtgctcaaaaacaccgac
aaccacgaaacggcattcacggtctccatcgatcatgtcgataccactacaggcatctcg
gcggttgaacgcggcatcaccgcacggaaatgtatcgacccaaacgcacggccggaggat
tttcgaagacccggccatatgttcccgctgcaggcaaaggacaatggtgtattcgagcgt
gagggacatacggaagcaaccgtcgatctgatgaaactggcaggactcagagaagcagga
ctctgctgcgagatcatggcggacaacggtgaaatgatgcggacccctgagcttatttcg
atggccaagcagtataacttaacctttgtgaccatcaaagacctccaggcctaccggaga
aagcaggaagcttcggctcttgccgttgaacagaaaaatatgagtccaatggactgttaa

DBGET integrated database retrieval system