KEGG   Methanocorpusculum labreanum: Mlab_0396Help
Entry
Mlab_0396         CDS       T00472                                 

Definition
(RefSeq) aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
  KO
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mla  Methanocorpusculum labreanum
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Mlab_0396
Enzymes [BR:mla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Mlab_0396
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Mlab_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(372850..373509)
Genome map
AA seq 219 aa AA seqDB search
MFTFNTIEEALKSLQNGEMIIVTDDENRENEGDLICAAEYATTENVNFMAKYGRGLICMP
MGRSLVEKLCLPPMVLKNTDNHETAFTVSIDHVDTTTGISAVERGITARKCIDPNARPED
FRRPGHMFPLQAKDNGVFEREGHTEATVDLMKLAGLREAGLCCEIMADNGEMMRTPELIS
MAKQYNLTFVTIKDLQAYRRKQEASALAVEQKNMSPMDC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatttaacacgatcgaagaggccctgaaatcccttcaaaacggagagatgatc
atcgtcaccgatgatgagaaccgagagaacgaaggtgacctgatctgtgccgccgaatat
gccacgacggaaaatgtcaacttcatggcaaaatacggcagagggctgatctgcatgccg
atgggacgcagtctcgtcgaaaaactttgtctcccgccgatggtgctcaaaaacaccgac
aaccacgaaacggcattcacggtctccatcgatcatgtcgataccactacaggcatctcg
gcggttgaacgcggcatcaccgcacggaaatgtatcgacccaaacgcacggccggaggat
tttcgaagacccggccatatgttcccgctgcaggcaaaggacaatggtgtattcgagcgt
gagggacatacggaagcaaccgtcgatctgatgaaactggcaggactcagagaagcagga
ctctgctgcgagatcatggcggacaacggtgaaatgatgcggacccctgagcttatttcg
atggccaagcagtataacttaacctttgtgaccatcaaagacctccaggcctaccggaga
aagcaggaagcttcggctcttgccgttgaacagaaaaatatgagtccaatggactgttaa

DBGET integrated database retrieval system