KEGG   Methanocorpusculum labreanum: Mlab_0461Help
Entry
Mlab_0461         CDS       T00472                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00340  Histidine metabolism
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mlab_0461
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mlab_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PPR
Motif
Other DBs
NCBI-ProteinID: ABN06635
UniProt: A2SQM9
Position
437899..439110
Genome map
AA seq 403 aa AA seqDB search
MRRGSLADVKESVEAIIEDVRTNGDAALFALTEKFDKQKLSSLQISPEAIDAAYDEVDPA
LVQALIEAEARITRFHELQMDKSLWLEETEPGITLGVKTTPLDRVGAYIPGGRAAYPSTV
LMTTVAARVAGVPEIVLFTPPPVNPLTLVALDIAGVTEAYSVGGAQAIAALALGTETIRP
VQKIVGPGNVFVTQAKMLLRESAEIDFPAGPSEIGVLADESANPAFIAADILAQAEHDPN
AACVLVTTSERIALDVGAEIERQIRSAPRREIMEKALAHSGYVIAGDLDEAIDLMNEIAP
EHLSIQTADPLTTLGKIRHAGSIFIGPYTPVACGDYASGTNHVLPTAGYAKSYSALDVHH
FMKRSQVQMVTKEGLGMIGDVVEILAEAEGLAAHAASVTIRRS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcggctcgctggccgacgtaaaggaatcagtcgaggcgattattgaggatgtc
cgtaccaacggggatgccgctctttttgccctgacggaaaagttcgataagcagaaactc
tcttcccttcagatatcccccgaagcgatcgatgcagcgtatgatgaggtcgatcctgcc
cttgtccaggcactgatcgaggccgaggcccgcatcacccggttccacgaactccagatg
gataaatcgctctggctcgaggaaacggaaccgggcatcacgctcggcgttaaaacgaca
cctctcgaccgtgtcggggcttatattcccggcggtagggcggcatatccttccactgtc
cttatgaccaccgtcgcagcccgcgttgccggcgttccggagatagttcttttcacgccg
ccgccggtaaacccgctgaccctagtcgctctcgatattgccggagttacggaagcctac
tctgtaggcggagcccaggcaatagcagcgctggctcttggaaccgaaacgatccgcccg
gtccaaaagatcgtaggacctggaaacgtcttcgttacacaggcaaaaatgctcctgcgt
gaatctgcggagatcgactttccggccggaccaagcgagatcggcgttcttgcagacgag
tcggcaaaccctgcattcattgcagccgatatccttgctcaggccgaacacgacccgaac
gcggcctgtgttctcgtgaccacatcagagagaatcgcactggacgtcggagctgagatc
gaacgtcagataaggtccgctccgcgccgcgagatcatggaaaaagctctagcccactca
ggttacgtgatcgccggggatctggatgaagcgatcgatctgatgaatgagatcgctcct
gagcatttgtcgattcagaccgccgacccacttaccacacttggaaaaatccgtcatgca
ggttcgatttttatcggtccgtacacgccggttgcctgcggggattatgcatcaggaacc
aaccatgttctcccaacggccggatatgcaaagagctactcggctctggacgttcaccac
ttcatgaaacgttcgcaggtccagatggtcacaaaagaaggcctgggcatgatcggcgat
gttgtggagatactggcagaagccgaagggcttgccgcccatgccgcgtcggtaacgatc
cgtcggtcctga

DBGET integrated database retrieval system