KEGG   Methanocorpusculum labreanum: Mlab_0487Help
Entry
Mlab_0487         CDS       T00472                                 

Definition
(RefSeq) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mla  Methanocorpusculum labreanum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_0487
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mlab_0487
   00640 Propanoate metabolism
    Mlab_0487
   00660 C5-Branched dibasic acid metabolism
    Mlab_0487
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_0487
Enzymes [BR:mla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mlab_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
459801..460886
Genome map
AA seq 361 aa AA seqDB search
MKFREYEAKQIFREAGIPVPNSVLITSADEANAAQKKVAEKVVLKAQVDVGGRGKAGGIL
PANAENISDVARDLFAKTIKGLPVEKILVEEALEISHEYYLSITIDRAKKMPLILFSSEG
GVEIETLAKERPEALRRVYVDPSFVTLPDFIVRNVIGTNPKEIGTIVRDLFAVFRSRDAV
LAEINPLVMTPKGILAADGKIILDDNSLIRQGISENRDLTPREAEAEKHGFSYVELEGNI
GVIGNGAGLTMATLDIISHYHGKAANFLDVGGGAASDRVMYAVQLVASMPGVKVIVVNLL
GGITRCDEVAKGIIEAGVPQPVIVRIAGTNEEEGRRLLQECGYVMSDTMDAAIRAAVEVV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccgcgaatatgaagcaaaacagatcttccgggaagcaggaatcccggtgcca
aacagtgttctgatcacctccgccgacgaggcaaacgcggcccagaaaaaagtcgcggaa
aaggttgtcctcaaagctcaggtcgatgtcggcggcagaggtaaagccggcggcatcctt
ccggcaaacgcggaaaacatctcagacgtcgcccgcgatctgtttgcgaagaccatcaag
ggacttcccgtcgaaaagatcctggtcgaagaagcgctcgagatctcacacgaatattat
ctgagcatcacgattgaccgtgcgaaaaagatgccgctgatcctcttttccagcgaagga
ggagttgagatcgagaccctcgcaaaggaaaggccggaggcgctccgccgcgtctatgtt
gatccgtcctttgtcacgctcccggatttcatcgtccgaaacgtcatcggaacgaatcca
aaagagatcggaacaattgtcagggatctttttgccgttttcaggtccagggacgccgtt
cttgcagagatcaatcctctggttatgacgccgaaaggcattctcgcagcagacggcaag
atcattctggatgacaactctctgatccgtcagggaatctccgagaacagagacctcaca
ccccgcgaagctgaggccgagaaacacggtttttcctatgtcgaactggaaggaaacatc
ggcgtgatcggaaacggcgcgggtctaaccatggcaaccctcgatatcatctcccattat
cacggaaaagccgcgaacttcctggatgtcggcggcggagctgcttcggaccgggttatg
tatgcagtccagctggttgcttccatgcccggcgtcaaagtgatcgtggtcaatcttctc
ggcgggatcacacgctgcgacgaggttgccaaaggaatcattgaggcaggagtcccgcag
ccggtgatcgttcggatcgccggtacaaacgaggaggaaggccgaagacttcttcaggaa
tgcggatatgtcatgtctgacactatggatgcggcgattcgtgccgcagtggaggtagta
caatga

DBGET integrated database retrieval system