KEGG   Methanocorpusculum labreanum: Mlab_0785Help
Entry
Mlab_0785         CDS       T00472                                 

Definition
alpha-phosphoglucomutase / phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_0785
   00030 Pentose phosphate pathway
    Mlab_0785
   00051 Fructose and mannose metabolism
    Mlab_0785
   00052 Galactose metabolism
    Mlab_0785
   00500 Starch and sucrose metabolism
    Mlab_0785
   00520 Amino sugar and nucleotide sugar metabolism
    Mlab_0785
  Nucleotide metabolism
   00230 Purine metabolism
    Mlab_0785
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mlab_0785
Enzymes [BR:mla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mlab_0785
    5.4.2.8  phosphomannomutase
     Mlab_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(767272..768648)
Genome map
AA seq 458 aa AA seqDB search
MAFEKREKKYFGTNGVRGVTGVDMTPVFALSVAEAFGTMLGEGKKVGVGRDTRTSGPALS
SAVRSGLMACGCDVVDFDVIPTPGLQYLVLDHKLDGGVMITASHNPPEYNGIKIIEADGT
EMGDERTLELEELMIQNGSVVSAWDKVGECTEEPEARKLYIDSIVAQFPKDCGKGITVVV
DPGNGPAAATTPEILRRLGCNVHTINAEFNGLFPGRLPEPSPEGLANLSALVQATGAAFG
VAHDGDADRAIFVDENGTFMDGNITFALLASYFCEKNPGGTIVTPVSTSGIVEEVGKKYN
CTTTYTVVGSIYVARTMRELIANGENVVIGGEGNGGIIYPKHQFCRDGGMSAATMLGFVA
GKTEPLSKLIAELPSFTMYQEKRKTAQAKEIVIHMKTYFADCPIDDRDGMRITRGGAWAL
IRPSGTEPLVRVFAESQDPAEAKTLLDEIFAEIKPYLE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaaacgcgagaagaaatactttggtacaaacggtgtccgcggagtgacc
ggagtcgatatgaccccggtatttgctctcagtgtcgccgaggcattcggaacaatgctc
ggcgaaggcaaaaaggtgggggtcggccgcgacaccagaacctcgggacctgcgctgagt
tctgcggtccgctcagggcttatggcatgcggatgcgacgttgtcgacttcgatgtgatc
ccgacaccgggcctccagtacctcgttcttgatcacaaacttgacggcggtgtcatgatc
accgcatcccacaacccgcccgagtacaacggcataaaaatcatcgaagctgacggaacc
gagatgggagacgaacgaacactcgaactcgaagagctcatgatccaaaacggctcggtc
gtctccgcctgggacaaagtcggtgaatgcacggaagaaccagaggcacgtaaactctat
atcgattcaatcgtcgcacagttcccaaaagactgcggcaaagggataacggtcgttgtc
gatccgggaaacggtccggcagccgctacgacccccgaaatcctgcgcagacttggatgt
aatgttcacaccatcaatgccgagttcaacggactcttcccgggcagacttcccgaaccg
agtcctgaaggacttgcaaatctctcagccctggtccaggcaaccggcgcagcattcgga
gtggcgcacgacggggatgcggatcgggcgatcttcgttgatgaaaacgggactttcatg
gacggaaacatcacgtttgccctgctcgcctcctacttctgcgagaaaaacccaggaggt
acgatcgtaactccggtcagcacatccggcatcgtcgaagaagtcgggaaaaaatacaac
tgcacgaccacctacacggttgtcgggagcatctacgtggcacggaccatgcgcgaactc
atcgcaaacggagaaaatgtcgtcatcggcggggaaggaaacggcgggatcatttatcca
aagcaccagttctgcagagacggcggaatgagcgctgcaacgatgctcggatttgttgcc
ggaaagaccgagccgctttcaaaactcatcgcagaacttccgtcattcaccatgtatcag
gaaaaacgaaaaaccgcacaggcaaaagagatcgtaatccatatgaaaacctattttgcg
gactgcccgatcgacgaccgtgatgggatgcggataacacgcggcggggcatgggccttg
atcagaccatccggaacggaaccgctggtcagggtctttgccgagtcacaggatccggca
gaagcgaaaaccctgctcgatgaaatttttgccgagataaaaccctatctcgaataa

DBGET integrated database retrieval system