KEGG   Methanocorpusculum labreanum: Mlab_0792Help
Entry
Mlab_0792         CDS       T00472                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mla  Methanocorpusculum labreanum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mla00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mla00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
775003..775914
Genome map
AA seq 303 aa AA seqDB search
MTHEQKNILSVRDMEREEIDKLLCSAAAFDRGNYTGRELEGKILAVLFFEPSTRTRMSFS
AAMMRLGGKILNLGSVEATSITKGETLSDTIRVISGYCDAIVLRHPKEGAARLASEVASV
PVINGGDGAGQHPSQTLLDLFTIRESMRIENIDVGLQGDLRYGRTVHSLAFALAKYNNVR
LHTIAPDGLDFPRYIKEDLRDIGVELIAHDHIEQALPELDVLYVTRLQRERFPDPVAFAN
YASTYRITPELLECAKPGMIVLHPLPRVDEIDPAVDSLPCAKYFEQAHNGVPIRMAMLNE
VIN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgaacaaaaaaatatcctctctgtacgggatatggaacgtgaagaaatcgac
aaacttctctgttccgctgccgcatttgatcgtggaaattataccggccgcgaactggaa
ggcaaaatcctggccgtcctctttttcgaaccaagcacccggacccgcatgtccttctcc
gctgcgatgatgcgtcttgggggcaaaattctgaatctcggctcggttgaagctacctcc
atcactaaaggtgagactctttccgacacgatccgcgtcatttccggatactgcgatgcg
atcgttctgcgccaccccaaagagggtgccgcccgtcttgcaagcgaggtcgcttccgtt
cccgtcatcaacggcggggacggagcaggtcagcatccctcccagacattactcgatctc
tttaccattcgcgagtcgatgcggatcgaaaacatcgacgtcggactccagggcgatctt
cggtatggccggaccgtccactctcttgctttcgccctggccaaatacaataatgtgcgg
ctccatacgatcgctcccgacggactcgattttcccagatatattaaagaggatcttcgc
gatatcggcgtcgaacttatcgcccatgaccatatcgagcaggcacttcccgaactcgat
gtcctgtatgtgacccgtcttcagcgggaacgtttccccgacccggttgcttttgcaaac
tatgcctccacctaccggatcacgcccgaacttctggaatgtgccaaacccggcatgatc
gtgctccatcccctcccccgtgtggacgagatcgatccggcggtcgattcccttccatgt
gccaaatacttcgaacaggcgcacaacggagtgccgattagaatggcgatgctgaacgag
gtgatcaactaa

DBGET integrated database retrieval system