KEGG   Methanocorpusculum labreanum: Mlab_0834Help
Entry
Mlab_0834         CDS       T00472                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mla  Methanocorpusculum labreanum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mla00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
813416..814375
Genome map
AA seq 319 aa AA seqDB search
MQLTGWMEENGRLLDRAEIEIFSVSRLSACGGEFLLETDDCFIRDKYHIMPGNPKGKPVI
TAEPIVSGMSLDEAIQTAVSLRASDDAVTTLSGGVDSSLVAALAGLPCIAVGLSGSHDLI
AAQQTAEILDLPITVKEIGIDDIRAALDDVLEIIPRVTPLDVEIGITGYFIAALAKETGA
KRILTGQAADELFGGYARYGRSSDLRADLEADFAGLVQQRERDAAVASHFGVWYSLPFMD
ERVVRASRTFSPEELVKGDLRKIAIRSVAAKHLPEEIAWRPKKAMQYGSGISSALAKIAK
SEGCKGCRELIQKLVPDKL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaccggctggatggaagagaacggccggctgctcgaccgtgccgagatcgaa
atcttttctgtatccagactctcggcatgcggcggcgagtttcttctggagacggatgat
tgcttcatccgcgacaaataccacatcatgcccgggaacccaaaagggaagccggtcatc
accgccgaaccaatagtttccggcatgtccctcgatgaagcgatccaaacggccgtttcg
ctccgggcatccgatgacgccgtgaccacgctttcaggcggcgtggactcatccctcgtc
gctgcccttgccggactcccctgcatcgcggtagggctttccggttcgcatgatcttatc
gccgcacaacagactgccgagatcctcgacctcccgatcaccgtaaaagagattggtatc
gacgatattcgggcggcactcgacgacgttcttgaaatcatcccgcgggtcacaccgctc
gacgtcgagatcgggatcaccggatacttcatcgccgctctcgcaaaagagaccggggca
aaaaggatacttaccggtcaggcagccgatgaactcttcggcggatacgcacgatacggc
agatcctccgatcttcgtgccgatcttgaagccgactttgccggccttgtccagcaaagg
gaaagggacgcggcggttgcctcgcatttcggcgtctggtattccctgccctttatggac
gagcgggtcgttcgtgcatcccggacgttcagccccgaagaactggtaaagggcgacctt
cgaaagatcgccattcgaagtgttgccgccaaacatctcccggaagagatcgcctggaga
ccaaaaaaagccatgcagtatggaagcggcatctcctcggcgttagcaaaaatcgcaaaa
tcggaaggatgcaaaggatgccgggaactgattcaaaaactcgtcccggataagctataa

DBGET integrated database retrieval system