KEGG   Methanocorpusculum labreanum: Mlab_0834Help
Entry
Mlab_0834         CDS       T00472                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mla  Methanocorpusculum labreanum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mlab_0834
Enzymes [BR:mla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mlab_0834
Peptidases [BR:mla01002]
 Cysteine Peptidases
  Family C44
   Mlab_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
813416..814375
Genome map
AA seq 319 aa AA seqDB search
MQLTGWMEENGRLLDRAEIEIFSVSRLSACGGEFLLETDDCFIRDKYHIMPGNPKGKPVI
TAEPIVSGMSLDEAIQTAVSLRASDDAVTTLSGGVDSSLVAALAGLPCIAVGLSGSHDLI
AAQQTAEILDLPITVKEIGIDDIRAALDDVLEIIPRVTPLDVEIGITGYFIAALAKETGA
KRILTGQAADELFGGYARYGRSSDLRADLEADFAGLVQQRERDAAVASHFGVWYSLPFMD
ERVVRASRTFSPEELVKGDLRKIAIRSVAAKHLPEEIAWRPKKAMQYGSGISSALAKIAK
SEGCKGCRELIQKLVPDKL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaccggctggatggaagagaacggccggctgctcgaccgtgccgagatcgaa
atcttttctgtatccagactctcggcatgcggcggcgagtttcttctggagacggatgat
tgcttcatccgcgacaaataccacatcatgcccgggaacccaaaagggaagccggtcatc
accgccgaaccaatagtttccggcatgtccctcgatgaagcgatccaaacggccgtttcg
ctccgggcatccgatgacgccgtgaccacgctttcaggcggcgtggactcatccctcgtc
gctgcccttgccggactcccctgcatcgcggtagggctttccggttcgcatgatcttatc
gccgcacaacagactgccgagatcctcgacctcccgatcaccgtaaaagagattggtatc
gacgatattcgggcggcactcgacgacgttcttgaaatcatcccgcgggtcacaccgctc
gacgtcgagatcgggatcaccggatacttcatcgccgctctcgcaaaagagaccggggca
aaaaggatacttaccggtcaggcagccgatgaactcttcggcggatacgcacgatacggc
agatcctccgatcttcgtgccgatcttgaagccgactttgccggccttgtccagcaaagg
gaaagggacgcggcggttgcctcgcatttcggcgtctggtattccctgccctttatggac
gagcgggtcgttcgtgcatcccggacgttcagccccgaagaactggtaaagggcgacctt
cgaaagatcgccattcgaagtgttgccgccaaacatctcccggaagagatcgcctggaga
ccaaaaaaagccatgcagtatggaagcggcatctcctcggcgttagcaaaaatcgcaaaa
tcggaaggatgcaaaggatgccgggaactgattcaaaaactcgtcccggataagctataa

DBGET integrated database retrieval system