KEGG   Methanocorpusculum labreanum: Mlab_0899Help
Entry
Mlab_0899         CDS       T00472                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mla  Methanocorpusculum labreanum
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mlab_0899
   00052 Galactose metabolism
    Mlab_0899
   00500 Starch and sucrose metabolism
    Mlab_0899
   00520 Amino sugar and nucleotide sugar metabolism
    Mlab_0899
Enzymes [BR:mla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mlab_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
890562..891500
Genome map
AA seq 312 aa AA seqDB search
MKKTYNNRRETYFNYFSSGENQFMKQVRKAVIPAAGWGTRFFPITKAMPKEMVPVVDKPV
IQYVVEEAVASGCDDILIITGKNKRAIEDHFDNSQELNEHLRNSGDLKLLAESEKLADLA
DIHFIRQKEQKGLGDAILCAKQHVGDEPFTVLLGDTICIPDAEAKPCTAQLIDIYKRYKL
PVIGVETVPEHKIKDYGIIDGILLEERLYQIKDIIEKPTPEEAPSNVGAMGRYLLTPEIF
AILEDTKPGRKGEIQLTDALRHYDASLGYVAKNTRYDIGDIPGWMVSNLQLLLKHPLYGD
MIRDALEKELNQ
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgtataataatcgaagagagacatattttaactatttttcatcaggagag
aatcaattcatgaaacaggttcgaaaggcagtcatccctgccgcaggatgggggacgcgc
ttcttcccgatcacaaaagcgatgccaaaggagatggtgccggtcgttgacaaaccggtc
atccaatatgttgtcgaagaagcggttgcatccgggtgcgatgacatcctgatcatcacc
ggcaaaaacaaacgcgctatagaggatcactttgacaattcccaggagcttaacgaacat
ctgagaaacagcggggatctaaagctacttgccgaaagtgaaaaacttgcagatcttgcc
gacatccacttcatcagacaaaaagagcagaagggtcttggagatgctattctctgtgct
aagcagcatgtgggtgatgaaccgtttactgttcttcttggggacacgatctgcataccc
gatgctgaggcaaagccatgcacggcacagttaatcgatatctacaaaagatacaaactc
ccggtcatcggcgtggaaaccgttcctgaacataagatcaaagattatggcatcattgat
ggtatacttcttgaagaaaggctctatcagatcaaagacatcatagaaaaaccaactccc
gaagaggctccatccaatgtcggagcaatgggcagatatctgctcaccccggagatcttt
gcgattcttgaggatacaaagcctggcagaaaaggcgagatccagctgaccgatgcactg
aggcattatgatgcatcacttggatatgttgctaaaaatacgagatatgatattggtgat
attcccgggtggatggtttcaaatctccagcttctcttgaaacatccgctctacggcgat
atgatccgagatgcgctggaaaaagaactgaatcaataa

DBGET integrated database retrieval system