KEGG   Methanocorpusculum labreanum: Mlab_0995Help
Entry
Mlab_0995         CDS       T00472                                 

Definition
inositol phosphatase/fructose-1,6-bisphosphatase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mla  Methanocorpusculum labreanum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mla00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
996869..997918
Genome map
AA seq 349 aa AA seqDB search
MELTDINTLLEKLSNAHGISSRESEIAKIIRAEIADYVDEIKTDKMGNLIAVKKGDDFKI
MLAAHMDEIGMMVQFVDDHGFIRFVAVGGWYNPVMVGQRVILHGEKGDVYGVLGNKPPHV
MTEEDKKKPIDMADLFIDIGAKSPEEVEALGITVGTSVTMDRQYTRLAGTTVTGKAMDNR
AGCAMLIGALKEMKTTHTIYAVFTVQEEVGLKGAKTSSFTLNPDVAIATDVTIPGDSPGV
ERRKAPVYMGKGPVIGMASASGRGHLADPRIVDWLVKTGKKFSIPCQIEVGDGGNTDASA
INFERGGIPSVPMSVPARYIHSPVEVIDLKDLEAAIHLLAKAVETKPKF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaacttactgatatcaatactttacttgaaaaactctcgaacgcacacggcatttcc
agccgtgaatcggagattgcaaagatcatccgtgccgagatcgcagattacgtggatgag
atcaaaaccgataagatgggcaatcttatcgcggtgaaaaaaggagacgacttcaagatc
atgcttgccgcccacatggacgagatcggcatgatggtccagttcgtggacgatcacgga
tttatcagattcgtcgcggtcggcggctggtataatccggtcatggtcggccagcgtgtg
atcctccacggagagaaaggcgacgtatacggtgttctcggcaacaaacccccgcacgtc
atgaccgaagaggataagaaaaagccaatcgatatggctgatctgttcatcgatatcggc
gcaaaatcccccgaagaggtcgaggctcttggcattacggtcggaacttccgtcacgatg
gacaggcagtacaccagacttgccgggaccacggttacgggaaaagccatggacaaccgt
gccggctgtgctatgctgatcggcgctctgaaagagatgaagaccacgcacactatatac
gcagttttcaccgtccaggaagaggtcgggcttaaaggcgcaaagacgagttctttcacg
ctgaaccctgacgtggcaattgcgacggacgtgacgatccctggcgactctcccggcgtc
gagcggcggaaagctccggtgtatatgggcaaagggccggtcataggcatggcgtcggcg
agcggccgcggccacctcgcagatccgcggatcgtcgactggctggtaaaaaccggaaag
aaattcagcatcccctgccagatcgaggttggagacggcggcaacacggatgcgtccgcc
atcaactttgaacgcggcggcatcccgagcgttccaatgtcggttccggcgcgatatatc
cactccccggtcgaggtcatcgacttaaaggatctcgaagcggcgatccatctgctcgca
aaagcagtcgaaacaaaaccaaaattctaa

DBGET integrated database retrieval system