KEGG   Methanocorpusculum labreanum: Mlab_1135Help
Entry
Mlab_1135         CDS       T00472                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1135
   01230 Biosynthesis of amino acids
    Mlab_1135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1135
   00030 Pentose phosphate pathway
    Mlab_1135
   00051 Fructose and mannose metabolism
    Mlab_1135
  Energy metabolism
   00680 Methane metabolism
    Mlab_1135
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlab_1135
Enzymes [BR:mla01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mlab_1135
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mlab_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1149156..1150058)
Genome map
AA seq 300 aa AA seqDB search
MSDIKVPLDVPKAMREAYIANYDLITAGSGRLMLFAGDQKIEHLNDDFYGAGIPEDDADP
EHLFRIASKANIGVLAAQLGLVVRYAMDYPEVPYLVKMNSKSHLVNVSQKDPVSPQLWSV
EQVVEIAQEHGIKIAGIGYTIYLGSEKEADMLAEAAQLINEAHFYGLVTVLWIYPRGKAV
GDEKDPHLIAGAAGVAACLGSDFVKVNAPKKDGKSSPELLREAVLAAGRTKLVCAGGSAT
TEEKFIRELYEQINVGGASGNATGRNIHQKSLDEAVKFCNAIYAVTVEGKSAEEALKLLQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatataaaggtccccctcgacgttcccaaagccatgcgggaagcatatattgcc
aattacgatctaattactgccggatcgggtcgcctgatgctctttgccggagatcagaaa
atagaacatctgaacgatgatttctacggcgccggcatccccgaagatgacgccgatccc
gaacacctcttccgcattgcctccaaggcaaacatcggcgttctggcagctcagctcggt
cttgttgtcagatacgcgatggattatccggaagtcccctatctggtgaagatgaactcc
aagtcgcatctggtgaacgtgtctcaaaaggatccggtctccccgcagctctggagcgtc
gaacaggttgtcgagatcgctcaggagcatggcatcaagatcgcgggtatcgggtatacg
atatatctcggcagcgaaaaggaggccgacatgctcgcagaggcagcccagctcatcaac
gaggctcacttctacggtcttgtaaccgttctctggatctatccgagaggaaaggcggtc
ggggacgagaaggatccgcatcttatcgcaggggcagctggtgtggccgcatgcctcggc
agcgatttcgtcaaggtcaatgcacccaaaaaagacggtaaatcctctcccgaactcctc
cgcgaggcggtccttgcggcaggacgcaccaaactggtttgtgccggcggctcggccaca
actgaggaaaagttcattcgcgaactctacgaacagataaatgtcggcggggcatcgggc
aacgctacgggcagaaacatccatcagaagtcactggacgaggcggtaaagttctgcaat
gcgatctatgcggtcaccgttgaaggaaagagcgccgaagaggcgctcaaacttcttcaa
taa

DBGET integrated database retrieval system