KEGG   Methanocorpusculum labreanum: Mlab_1172Help
Entry
Mlab_1172         CDS       T00472                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1172
   01230 Biosynthesis of amino acids
    Mlab_1172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1172
   00051 Fructose and mannose metabolism
    Mlab_1172
   00562 Inositol phosphate metabolism
    Mlab_1172
Enzymes [BR:mla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mlab_1172
Exosome [BR:mla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mlab_1172
  Exosomal proteins of bladder cancer cells
   Mlab_1172
  Exosomal proteins of melanoma cells
   Mlab_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1195222..1195887)
Genome map
AA seq 221 aa AA seqDB search
MSSPLILVNFKSYREGAGNAAGQIASAAELVMQESGVTIGIAPQFVELHPFCKHYEIPVY
AQHIDAVEGAFTGRIPAFTVRAAGCVGSLINHSERRLTIAEIEACVEAAKFNHLESVVCT
NNVGVSAAAAAFSPTYVAVEPPELIGSGISVAKADPDIIRNSVAAVKKISSDVKVLCGAG
IQSGECVKTAVDLGADGVLLASSVVKAKDPEAVLRDLVSLL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccgcttatcctggtgaacttcaagtcataccgcgaaggagcgggcaatgcg
gcaggacagatagcttcggccgccgaacttgtgatgcaggagtcgggcgtgactatcggt
atcgctccgcagtttgtggagcttcacccgttctgcaagcattacgagatcccggtgtat
gcccagcacatcgatgcggtggaaggagctttcaccggccggatccctgcattcacggtg
cgggcggccggctgtgttgggtcgctgatcaatcactcggaacgaagactgacgatcgca
gagattgaggcatgcgtcgaagcggcgaagttcaatcatctggagtcggtggtctgcacg
aacaatgtgggcgtttcggcagcggccgcggcgttttcgccgacgtatgtggctgtcgag
ccgccggaacttatcggctcgggcatctcggtcgcaaaagcggatcccgatatcatcaga
aattcggttgctgcagtgaaaaagatcagctcggacgttaaggtcctctgcggtgcaggc
atccagtcgggcgagtgcgtaaaaacggcggtcgatcttggagctgacggcgttctgctc
gcatccagcgtcgtgaaggcaaaggatccggaggccgtgcttcgcgatctggtgtccctt
ttataa

DBGET integrated database retrieval system