KEGG   Methanocorpusculum labreanum: Mlab_1265Help
Entry
Mlab_1265         CDS       T00472                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mla  Methanocorpusculum labreanum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mlab_1265
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mlab_1265
Enzymes [BR:mla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mlab_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1292480..1293667
Genome map
AA seq 395 aa AA seqDB search
MNAAKLCSDLIQIRSDNPPGDTSEIAEYILSVMEGLGIPGTITSGPDGHDNVISKDQAGR
LLLTGHIDVVPALNEGWKYPPYSGKIDDTCVHGRGATDMKGGCAAVLSAVARAKDAGDDL
PVSLAFVCDEEGGGRYGTRYLLEKNLIHPCDVLIAEPTPAYAPAVGQKGVCRFDVEFVGT
PGHSSLYPILGESAVIQAMDFLYWMGELHKRVYPQTEEMEKLIEHSTKIAGEGTTTDFGP
VFRQIMYNPGIISGGERVNIVAQKCTLMMDMRLPWGCDCDEILDEICSHIPKSAVLTPRT
KANASLTASDSFLVQKTCEAISEVYGITSRPMVQWAASDARALRLAGFRALEYGPGDLST
MHGLNEKVSIDQLNKCEEIYYRLIQNYTNTKQEIS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcaaagctctgctcagatctgatacagatacgtagcgacaatccgcccggc
gacacgagcgagattgccgaatatattttatccgtaatggaaggactcggcatccccgga
acgatcacctccgggcccgacggtcatgacaatgtcatatcaaaggaccaggccgggcgt
cttcttctcaccggacatatagatgtggtcccggcactgaacgagggctggaagtatccg
ccgtattccggcaagatcgacgacacctgcgtgcacggacgcggggcgaccgatatgaaa
ggcggatgtgccgccgttttgtcggcggttgccagagcaaaggatgcgggcgatgatctc
ccggtctctcttgccttcgtctgtgacgaggaagggggaggaagatacggcacccggtat
ctgctggagaaaaacctcatccacccgtgcgatgttttgatcgccgaaccgacgccggca
tatgccccggctgtcggacaaaaaggcgtctgcagattcgatgtggagtttgtcggaacg
cccggccattcatccctgtatccgattctcggtgaaagtgcggtgatccaggcgatggat
tttctctactggatgggagaactgcacaagcgcgtatatccgcagacagaggagatggaa
aaactcatcgagcactcgaccaaaatcgccggtgaaggaacgacgacggacttcggcccg
gtgtttcggcagatcatgtataatccgggcatcatttccggcggggaacgggtcaacatc
gtcgcccagaaatgtactctcatgatggacatgcggctcccgtggggatgcgactgtgat
gagatcttagatgagatctgcagccatatcccgaaatcggccgtcctcaccccccgaacc
aaagccaacgcttcgctgacggcgagcgactcgttccttgtgcagaaaacctgcgaagcc
atcagcgaagtgtacgggatcacctcgcgtccgatggtccagtgggccgcatccgatgcc
cgggcgcttcgcctggcgggtttccgtgctctcgaatacggacccggcgaccttagcacc
atgcacggcctgaatgaaaaggtctctatcgaccagctgaacaaatgcgaagagatctac
tatagactcatccagaactacacaaatacaaaacaggagatatcataa

DBGET integrated database retrieval system