KEGG   Methanocorpusculum labreanum: Mlab_1304Help
Entry
Mlab_1304         CDS       T00472                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mla  Methanocorpusculum labreanum
Brite
Enzymes [BR:mla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mlab_1304
Transfer RNA biogenesis [BR:mla03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mlab_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1328725..1330287)
Genome map
AA seq 520 aa AA seqDB search
MEEHTIYRELISLIFSDPNPDIQHIKLSVCRKYSLDAMPKNSAILAAAKPEEYEALRRVL
MVKPTRTLSGVAPVAVMTSPCACPHGKCLPCPGGPDHIFKSPQSYTGEEPAALRARQNEY
DPYRQVTARLGQFKLLGHHVDKAELIVMGGTMTARDAAYQEWFVSECLRAMNEFSGQKST
AGSVEELMLENEKADVRCIATTFETRPDWCREEHINKMLELGVTKVELGFQHTDDELLLL
NKRGHTVADSVLANTLLRDAGIKVGFHVMPNLYGSTIPRDREMFDTLFTDPRFCPDFLKI
YPTLVTPGAELEELWQKGEYKTYDEDDLVDLLAYAKSRLPPYVRLQRIQRDIPAKLIVSG
SIHGHIRQMAAERLKEQGGSCQCIRCREIGRRPSSAVDEEKTLVYPCCGGTEHFLSTTAG
ESLIGFVRLRFPGTVFRPELDGAALVRELHVYGEIVPLGVHGSGEKRQHRSYGQQLLSRA
EETARDAGYSTVAVMSGIGVRPYYHRQGYQRIGPYMIKNL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcacaccatttatcgtgagcttatctcactcattttttccgatccgaacccg
gatattcagcacatcaaactttccgtgtgccgtaagtattctctcgatgcgatgccgaaa
aattccgcgattctcgccgccgcaaaacccgaggagtacgaggcccttcgtcgcgttctg
atggtcaaaccgacacgaacactctcaggcgtcgctccggtcgcggtgatgacgtctcct
tgcgcctgtccgcacggaaaatgtctgccgtgccccggaggacctgatcacatattcaaa
tcaccccagagttacaccggagaagaaccggcggctctgcgtgcccgtcagaatgagtat
gatccgtaccgtcaggtgaccgcaagacttgggcagttcaaacttctcggacaccatgtc
gataaagccgagctgatcgtgatgggggggacgatgaccgcccgggacgctgcatatcag
gaatggttcgtttccgaatgtctgcgggcgatgaacgagttctccggacaaaaatccacc
gcgggatcggtggaagagctgatgctcgagaacgaaaaagccgatgtccgctgtatcgcg
acaaccttcgagacccgtcccgactggtgtcgggaggaacatatcaataagatgcttgaa
ctgggcgtgaccaaagtcgaactcgggttccaacacaccgatgatgaactcctgctgtta
aacaaacgcggccacacggttgctgacagcgttttggcaaacacgctccttcgggatgcc
ggcatcaaagtcggctttcatgttatgccgaatctgtacggaagcacgattccgcgtgac
cgggagatgttcgatacgctcttcaccgacccaagattttgtccggattttctaaagatc
tatccaacattggtcacccccggcgcagaactcgaagaactctggcaaaagggagaatac
aaaacatatgacgaggatgaccttgtcgatctcctcgcctacgcaaaaagcaggcttcct
ccctatgtcagacttcagcgtatccagcgggatattcctgcaaaactcatcgtctccggt
tcgattcacgggcacatacgtcagatggctgctgaaagactcaaagaacagggagggagc
tgccagtgtatccggtgtcgggagatcggtcgccgcccgagttctgccgtggatgaggag
aagaccctcgtgtatccttgctgtggggggacagaacatttcctttcgaccactgccgga
gaatcactgatcggttttgttcgtctgcggtttcccggaaccgtattcagaccggagctc
gacggtgcggctctcgttcgagaactccacgtgtacggcgaaatcgtccctctcggtgtg
catgggtcaggagagaagcgtcagcacagatcctacggtcagcagttattgtcgcgtgcc
gaagaaactgcgcgggatgccggatattccacggtggccgtgatgagcggcattggggta
agaccctattatcatagacagggatatcagcgtataggtccatatatgattaagaatcta
tga

DBGET integrated database retrieval system