KEGG   Methanocorpusculum labreanum: Mlab_1332Help
Entry
Mlab_1332         CDS       T00472                                 

Definition
coenzyme F420-0 gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mla  Methanocorpusculum labreanum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mlab_1332
Enzymes [BR:mla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Mlab_1332
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Mlab_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1360838..1361575
Genome map
AA seq 245 aa AA seqDB search
MSVQVTGISGIPLIQKGDDLPAIICRNTTFEDEDILCIASTIVSKAKGYTRALADITPSP
DALRISGLTKEDPRFIQAILDSSTEIIQEYPFILSEVPCGHVGVRAGVDNSNIEGENIII
LPKDPSAECREIRDSIKKITGKNVGVIVTDTCGRAFRRGQCGNAIGWAGMTAIRDFRGDH
DLFGLELEITEEAVVDEIAAFSNFIMGESNNGIPAVKFSGCGTWKGHDSLYFTKEEDLIR
KAMKR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttcaggtaacgggaatttccggaatcccgctcattcagaaaggcgatgatctc
ccggcaataatctgcagaaataccacgttcgaagacgaggatatcctttgtatagcatca
acgatcgtttcgaaagcaaaagggtatacccgcgctctcgcagatatcaccccttcgccg
gatgccctgcggatctccggcctcaccaaagaagacccccggttcatccaggcgatcctt
gattcatccaccgagatcatccaggagtatccgtttatcctctccgaagtcccctgcggc
cacgtaggtgtgcgcgccggtgtggacaatagtaatatagaaggcgaaaatatcatcatc
cttccaaaagacccctcggccgagtgcagagaaatacgtgactcaataaaaaagatcacg
ggaaagaatgtcggcgtcatcgtgaccgacacctgcggcagggcatttcgccgcggtcag
tgcggaaacgctatcggctgggcaggcatgaccgcgatccgtgactttagaggcgaccac
gatctgttcggtctggaactcgaaatcacggaagaagcggtcgtcgatgagatcgccgcc
ttctccaacttcattatgggggagagcaacaacgggatcccggccgtgaaattttccggc
tgcggtacctggaaaggccacgactcgctctacttcaccaaagaagaagacctgatcaga
aaggctatgaaacgataa

DBGET integrated database retrieval system