KEGG   Methanocorpusculum labreanum: Mlab_1396Help
Entry
Mlab_1396         CDS       T00472                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01130  Biosynthesis of antibiotics
mla01230  Biosynthesis of amino acids
Module
mla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlab_1396
Enzymes [BR:mla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mlab_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG Dioxygenase_N
Motif
Other DBs
NCBI-ProteinID: ABN07562
UniProt: A2STA6
Position
complement(1425529..1426296)
Genome map
AA seq 255 aa AA seqDB search
MILDDICARSRERAALLDPSIRKTSEETTYVPQSLIKSVKNCQGRKNAVIAEIKYKTPSD
KTLDSRRDPANLSRLYESGGACAVSVLTEPFYFSGSAENLTKAKSGTRLPILRKDFIVDE
KQIYETYVMQADSVLLIADVLQDRLEEFILLCQSLHLEPLVEVRNREDAENAVKSGALLT
GINNRNLHDMSVDTKTTEELSCLLRDAGLTVISESGIKTPEDVLGLKNLCDGFLIGTSLM
KSADPQKTLEAFVCV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgatgacatttgtgcccgctcaagagaaagggcagcactgctcgacccctct
ataaggaaaacctccgaagagacaacctatgttccgcaaagcctcatcaaatccgtgaaa
aactgccagggccggaaaaatgcggttatcgctgagatcaaatacaaaactccctcggac
aaaacccttgactcgaggagggatccggcgaacctctcccgtctgtatgaatcgggcggg
gcatgtgctgtttccgttctgactgaacctttctacttctccggaagtgcggaaaatctc
accaaagcaaaatccgggacccggcttccgatccttagaaaggatttcatcgtcgatgaa
aaacagatctacgaaacctacgtcatgcaggccgattcagtgcttctgatagccgatgtt
ctgcaggaccggcttgaagagttcatccttctttgccagtctctgcatctcgaacctctg
gtcgaggtcaggaaccgggaagatgcggaaaatgccgtaaaatccggggcactgctgacc
ggcatcaataaccggaatctccatgacatgtcggtcgatacgaaaacaacagaagaactc
tcatgccttcttcgggatgcgggtcttactgtgatctccgagagcggcatcaaaacacct
gaggatgtccttggtctgaaaaatttatgtgacggttttctcattggaacctctctcatg
aagtctgcagatccgcaaaaaactttggaggcattcgtatgcgtgtaa

DBGET integrated database retrieval system