KEGG   Methanocorpusculum labreanum: Mlab_1416Help
Entry
Mlab_1416         CDS       T00472                                 

Definition
pyruvate ferredoxin oxidoreductase, delta subunit (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1416
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1416
   00020 Citrate cycle (TCA cycle)
    Mlab_1416
   00620 Pyruvate metabolism
    Mlab_1416
   00640 Propanoate metabolism
    Mlab_1416
   00650 Butanoate metabolism
    Mlab_1416
  Energy metabolism
   00680 Methane metabolism
    Mlab_1416
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_1416
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1446415..1446681
Genome map
AA seq 88 aa AA seqDB search
MALGIGCTARPGNSRNNKTGSWRVFYPVMDTEKCTKCGTCQLICPEGCINQNPDKTYSID
LDFCKGCGMCAEECPDKAKAIHMVKEEK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggctcttggaattggatgcacggcacgcccgggcaacagcagaaacaacaaaaccggt
tcatggagagtattctacccagtaatggacacggaaaaatgtacaaaatgtggaacatgt
cagctgatctgtccagaaggttgtatcaatcagaatcctgacaaaacctattctatcgat
cttgacttctgtaaaggatgcggcatgtgcgccgaggaatgtcctgacaaagctaaggct
atccacatggttaaggaggaaaaataa

DBGET integrated database retrieval system