KEGG   Methanocorpusculum labreanum: Mlab_1417Help
Entry
Mlab_1417         CDS       T00472                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00010  Glycolysis / Gluconeogenesis
mla00020  Citrate cycle (TCA cycle)
mla00620  Pyruvate metabolism
mla00640  Propanoate metabolism
mla00650  Butanoate metabolism
mla00680  Methane metabolism
mla00720  Carbon fixation pathways in prokaryotes
mla01100  Metabolic pathways
mla01120  Microbial metabolism in diverse environments
mla01130  Biosynthesis of antibiotics
mla01200  Carbon metabolism
Module
mla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mla_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1417
   00020 Citrate cycle (TCA cycle)
    Mlab_1417
   00620 Pyruvate metabolism
    Mlab_1417
   00640 Propanoate metabolism
    Mlab_1417
   00650 Butanoate metabolism
    Mlab_1417
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_1417
   00680 Methane metabolism
    Mlab_1417
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_1417
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABN07583
UniProt: A2STC7
Position
1446682..1447839
Genome map
AA seq 385 aa AA seqDB search
MTMEIMEGSIAIAETVRLCRPQVISAYPITPQTHIVEGLASIVADGRLDAEYICVESEFS
ALSACIGASAAGSRVYSATTSQGLALMGEVVFNAAGMRLPIVMGIANRAISAPLSIWNDQ
QDSIMMRDSGWIQLYAEDNQEAIDMHILAYKVCEDHNILLPAFVCFDGFILSHVYEPIDL
PSQELVDSFLGPFNPYQKLDAKDPISFGMYATPEYYLEFRYEHDQAVKRAAEAIKKYGKE
FGEVFGRDYSELVVGYKLEDAETAIVAMGSICGTVKDAIDEMRAEGKKVGLLNLRCFRPF
PSTDVAKALAHVNTIAVLDKNVSLGAKGAVAIEIKEACYGSNIPIYDYILGLGGRDVRKR
DIKKIVELAEKGEGDMFYGLREEVL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggaaattatggagggttcgatcgcgatcgcagaaaccgtacgtctctgcaga
ccacaggttatctccgcatatccgatcaccccgcagacccacatcgtcgaaggactggcg
tcgatcgtggctgatggaagacttgacgcagaatacatctgtgtggagtctgagttttcc
gctctctcggcatgcatcggtgcctcggcagccggaagcagagtctattcggcaacgaca
tcccagggtctcgcactgatgggagaggtcgtgttcaacgcagcaggaatgagactgccg
atcgttatgggtatcgcaaaccgcgcgatttccgcaccgctctcgatctggaacgaccag
caggattcaatcatgatgagagactccggatggatccagctctatgcagaagacaaccag
gaggcaatcgacatgcacatcctcgcatacaaagtctgcgaagaccacaacattctgctc
ccggctttcgtttgtttcgacggatttattctgtcccatgtatatgagccgatcgacctc
ccctcgcaggaactcgttgactcattcctcggaccgttcaacccctatcagaaactggat
gcaaaggatccgatctcctttggtatgtatgcaacaccggaatactatctggagttcaga
tacgaacatgatcaggcggtcaaacgtgcggccgaagccattaaaaaatacggaaaagag
ttcggcgaagttttcggccgcgactactcggagctagtcgtcggttacaaacttgaagat
gccgaaaccgcaatagttgcaatgggttccatctgcggtaccgtcaaagacgcgatcgat
gagatgcgtgcagaaggaaagaaagtcggactcttgaatctccgctgcttccgtccgttc
ccgtcaaccgatgttgcaaaggctctcgcccatgtcaacaccatcgcagttctcgataaa
aacgtcagtctgggtgcaaaaggggcagtcgcaatcgaaatcaaggaagcctgctacgga
tcgaacataccgatctacgattatatccttggtctcggcggccgcgacgtacgaaagaga
gacatcaaaaagatcgtcgaactcgcagaaaaaggcgagggcgatatgttctatggatta
cgcgaggaggtgctctga

DBGET integrated database retrieval system