KEGG   Methanocorpusculum labreanum: Mlab_1418Help
Entry
Mlab_1418         CDS       T00472                                 

Definition
pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1418
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1418
   00020 Citrate cycle (TCA cycle)
    Mlab_1418
   00620 Pyruvate metabolism
    Mlab_1418
   00640 Propanoate metabolism
    Mlab_1418
   00650 Butanoate metabolism
    Mlab_1418
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_1418
   00680 Methane metabolism
    Mlab_1418
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_1418
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1447841..1448731
Genome map
AA seq 296 aa AA seqDB search
MVDRSIENFECGHRACGGCGASSAVRMILKGYGENTIVVNSTGCLEVFSTPYPETAWKTP
WIHSLFENASAVASGIEASLKKQGRLDTEKILVFGGDGATVDIGTLCISGAFERGHDFTY
ICYDNEAYMNTGIQRSGATPYDADTTTSPAGVCSTGNNLPKKDYPQILVAHGSPYVATAS
MAYPADLMKKVEKARNIKGPCYIQVHTPCCTGWGFDGAKTMEIGRMAVECGLWVNYEIID
GELTTVKKVKRVPVDDYLKAQKRFRHLFKPLRNDAEIAKIQAIADKNAKKYGIDIE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtagacagatctattgaaaactttgaatgcgggcacagagcctgcggaggctgcgga
gcatcatctgcagtccgtatgatcctgaaaggctacggcgaaaacacgatcgtagtcaac
tcaaccggatgcctggaggttttctcaacaccgtatccggaaaccgcatggaaaactccc
tggattcactcgctgttcgaaaacgcatcggcagtcgcatcgggtatcgaagcatccctc
aaaaagcagggacgtcttgacacggaaaagatcctcgtcttcggcggggatggtgccacg
gttgatatcggaacgctctgtatctccggcgcttttgaacgcggacatgacttcacatac
atctgctatgacaatgaagcatacatgaacacgggaatccagcggtccggggcaacaccc
tacgacgcagatacaacaacatctcccgcaggcgtctgctcaaccggaaacaaccttcca
aagaaagattacccgcagatccttgtcgctcacggttcgccttacgttgccaccgcttcc
atggcctaccctgcagatctgatgaaaaaagtcgaaaaagcacgaaacatcaaaggtccc
tgctatatccaggtacacacaccctgctgtaccggatggggattcgacggtgccaagaca
atggaaatcggcagaatggcagtcgaatgcggcctctgggtcaattacgaaatcattgac
ggcgaacttacaaccgtgaaaaaagtgaaaagagttccggtcgatgattacctcaaagca
cagaaacgcttccgtcacctcttcaaaccgctaaggaatgatgccgagatcgcaaagatc
caggcaattgccgacaaaaatgccaagaagtacggcatcgatattgaatag

DBGET integrated database retrieval system