KEGG   Methanocorpusculum labreanum: Mlab_1664Help
Entry
Mlab_1664         CDS       T00472                                 

Definition
quinolinate synthetase A
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
mla  Methanocorpusculum labreanum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mlab_1664
Enzymes [BR:mla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     Mlab_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1698116..1699018)
Genome map
AA seq 300 aa AA seqDB search
MNYEKEIKKLAAEKGALILAHNYQPAEIQDLADITGDSLELARKAKEAKESTLVVCGVYF
MAETAKILSPEKTVLIPRPDGGCPLADQLNPSAVLAAKKAHPGSPFVVYVNSNAATKAEC
DITCTSANAADVVRSLKEDTILFGPDANLAAYAQRLVPEKTIIPVPQDGGCPTHHQFSVR
DVEAARREYPNATIICHPECSPDVQLASDLVGSTGYMIRRCGEKKEWVILTEKGIIHPLQ
KKYPDTIFHGIDTAVCSNMKLITKEDLYITLRDGVVPIQVPESIADRARLAIERMIGASA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaactatgaaaaagagatcaaaaagctcgccgccgaaaaaggcgctttgatccttgca
cacaattatcagccggccgagatccaggatcttgccgacatcaccggagactcgctcgaa
cttgcccgcaaggcaaaggaagcaaaggagtcgacgcttgtcgtctgcggcgtctacttc
atggccgagacggcaaagattctctcgccggaaaagactgttctaatcccaagaccggac
ggcggatgcccgcttgccgatcagctgaacccttcagcggttcttgcagcgaaaaaagcc
catcccggttcgccgtttgttgtgtacgtgaactcgaatgcggcaaccaaagcggagtgc
gatatcacctgcacgtccgcaaatgccgcggatgtcgtccgttcccttaaggaagatacg
atcctgtttggtccggatgcaaatctcgcggcatatgcccagcgtctcgtacctgaaaaa
acgatcatccccgtcccgcaagacggcggctgcccaactcaccaccagttttccgtccgg
gacgtggaagcggcgagacgcgagtatccgaacgcgacgatcatctgccatccggaatgc
tctcccgacgttcagctcgcatccgatctggtcggctcgaccgggtacatgatccgcaga
tgcggcgaaaagaaagagtgggtgattctgacggagaaagggatcatccatccgttgcag
aaaaagtatccggacaccatattccacggtatcgatacggcggtctgttcaaacatgaaa
ctgatcacgaaagaggatctctacatcacgcttagggacggcgtcgttccgatccaggtg
ccggaaagcatcgcggaccgggcccgccttgcgatcgagcggatgatcggggcatcggca
taa

DBGET integrated database retrieval system