KEGG   Methanocorpusculum labreanum: Mlab_1664Help
Entry
Mlab_1664         CDS       T00472                                 

Definition
quinolinate synthetase A
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
mla  Methanocorpusculum labreanum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mla00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1698116..1699018)
Genome map
AA seq 300 aa AA seqDB search
MNYEKEIKKLAAEKGALILAHNYQPAEIQDLADITGDSLELARKAKEAKESTLVVCGVYF
MAETAKILSPEKTVLIPRPDGGCPLADQLNPSAVLAAKKAHPGSPFVVYVNSNAATKAEC
DITCTSANAADVVRSLKEDTILFGPDANLAAYAQRLVPEKTIIPVPQDGGCPTHHQFSVR
DVEAARREYPNATIICHPECSPDVQLASDLVGSTGYMIRRCGEKKEWVILTEKGIIHPLQ
KKYPDTIFHGIDTAVCSNMKLITKEDLYITLRDGVVPIQVPESIADRARLAIERMIGASA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaactatgaaaaagagatcaaaaagctcgccgccgaaaaaggcgctttgatccttgca
cacaattatcagccggccgagatccaggatcttgccgacatcaccggagactcgctcgaa
cttgcccgcaaggcaaaggaagcaaaggagtcgacgcttgtcgtctgcggcgtctacttc
atggccgagacggcaaagattctctcgccggaaaagactgttctaatcccaagaccggac
ggcggatgcccgcttgccgatcagctgaacccttcagcggttcttgcagcgaaaaaagcc
catcccggttcgccgtttgttgtgtacgtgaactcgaatgcggcaaccaaagcggagtgc
gatatcacctgcacgtccgcaaatgccgcggatgtcgtccgttcccttaaggaagatacg
atcctgtttggtccggatgcaaatctcgcggcatatgcccagcgtctcgtacctgaaaaa
acgatcatccccgtcccgcaagacggcggctgcccaactcaccaccagttttccgtccgg
gacgtggaagcggcgagacgcgagtatccgaacgcgacgatcatctgccatccggaatgc
tctcccgacgttcagctcgcatccgatctggtcggctcgaccgggtacatgatccgcaga
tgcggcgaaaagaaagagtgggtgattctgacggagaaagggatcatccatccgttgcag
aaaaagtatccggacaccatattccacggtatcgatacggcggtctgttcaaacatgaaa
ctgatcacgaaagaggatctctacatcacgcttagggacggcgtcgttccgatccaggtg
ccggaaagcatcgcggaccgggcccgccttgcgatcgagcggatgatcggggcatcggca
taa

DBGET integrated database retrieval system