KEGG   Methanocorpusculum labreanum: Mlab_1668Help
Entry
Mlab_1668         CDS       T00472                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1668
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1668
   00052 Galactose metabolism
    Mlab_1668
   00500 Starch and sucrose metabolism
    Mlab_1668
   00520 Amino sugar and nucleotide sugar metabolism
    Mlab_1668
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mlab_1668
   00524 Butirosin and neomycin biosynthesis
    Mlab_1668
Enzymes [BR:mla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mlab_1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1700731..1701702
Genome map
AA seq 323 aa AA seqDB search
MSNESTSSSTMDDHSYVAAVDLGATHLRAGIIDEEGEIQAFSQNEVKDCQSAVDIRLLIC
SMIEDLGETSGITPKAIGVSTAGPVDLKTGSVVGSPNMKCEQIFLAGPLEERFGIQVTMM
TDCKAGVLGEYYFGGAKDAETLVYLTFSTGIGAGVLERGKLLCGSNGNASEAGHFLVDTT
WNLPCGCGGTGHWEAYASGTGIPNFFQAWREARGDSEPKSSLNAGQILYIGNWGNPLFSS
FCDELAKINGRGISSVIAAYNPDLIVMDGPIVRNYPSLIAGRMTEYIDHYLTIPEIRISA
LEGKGPLLGASVSAFKALERRKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaaagcacatctagcagtacgatggatgatcattcgtatgttgccgcagtc
gatctgggagcgacgcatctgcgtgcaggaatcatagatgaagagggagagatccaggca
ttttcccaaaatgaggtcaaagattgccaaagcgccgtggatatccggttgctgatctgc
agtatgatcgaggatctcggcgaaacttcgggaattacgcccaaagcgatcggcgtcagc
accgcgggacccgtcgatctgaagaccggttcggtcgtcggttcgcccaatatgaaatgc
gaacagatctttcttgccggaccactggaggaaaggttcggcatccaggttacgatgatg
accgactgcaaagcgggcgtccttggcgagtattacttcggcggggcaaaggatgcggaa
acgctcgtctatctgaccttttccaccgggatcggggcaggagtcctggagaggggaaaa
ctcttgtgcggttcgaacggaaatgcctcagaggccggccactttctcgtggacacgacc
tggaatctcccctgcggatgcggagggaccggacactgggaagcctacgcgagcggaacg
ggcatcccaaactttttccaggcatggagagaggctcgcggcgattccgaaccgaaatcc
tcgctgaatgcaggacagatcctctacatcgggaattggggaaacccgctgtttagctct
ttctgcgatgaactcgcaaaaataaacgggcggggcatttcctcggtgattgcggcctac
aatcccgatctcatcgtaatggacggacccatcgtcagaaactatccgtcgcttattgcc
ggaagaatgaccgaatacatcgatcactacctcacgattcccgagatccggatctccgct
ctcgagggaaagggccctctgctcggcgcgtcggtctctgcgttcaaagcgcttgaacgc
aggaaattatga

DBGET integrated database retrieval system