KEGG   Methanocorpusculum labreanum: Mlab_1701Help
Entry
Mlab_1701         CDS       T00472                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1701
   01230 Biosynthesis of amino acids
    Mlab_1701
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1701
  Energy metabolism
   00680 Methane metabolism
    Mlab_1701
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlab_1701
Enzymes [BR:mla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mlab_1701
Exosome [BR:mla04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mlab_1701
  Exosomal proteins of melanoma cells
   Mlab_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1735846..1736778)
Genome map
AA seq 310 aa AA seqDB search
MADNTTEILVGNAFLDTPLFGEITYGNLLAAILILVGTYVVAKVLSVIVMRVLAGKVEVS
NSTFLAKIVRWLTYFVGIVAASPFLHIDFSGLIVAGGILAFAISFASQSTLSNFVAGVLL
MFERPVGVGDNISVNGTEGYVEDIGILSTTIRTYSGIFVRIPNESMFTSDITNYVAHIAR
RFDYDIGIRYSDDADKAIKVIKGIIEKHPYALKNPGPSVYVDELGNNSINLKVRIWAPSA
FWWDVRTDLLWKIFQALRKADIDIPFPQLTLWYGQEPPKPSKAGKGSGFTPQEVLGKSEV
SPENAVKVIK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacaccaccgagatcctcgtcggcaatgcatttctggatactccgcttttt
ggggagatcacctacggcaatctgttagcggccatcctcattctggttgggacgtatgtc
gtggcaaaagtcctttccgtcattgttatgcgtgtccttgccggcaaagtcgaggtaagc
aacagtacgtttctcgcaaagatcgttcgatggttaacctacttcgtcggtatcgttgcg
gcaagtccttttctgcacatagacttctccgggctgatcgtcgctggaggaattctggcg
ttcgcgatcagttttgcgtcgcaaagcacgctttccaacttcgttgccggcgttctgctg
atgttcgagaggccggtaggagtcggcgacaatatcagtgtgaacggaaccgaaggctat
gtcgaggacataggcattttgtccacgacgatccgtacctacagtggtatcttcgtccgt
atcccgaatgagtcgatgttcacctccgatatcacgaattatgtggcacatatcgcccgg
cggttcgattatgatatcgggatcagatactcggatgatgcggataaagcgatcaaagtc
atcaaaggtatcatcgagaagcatccgtatgccctgaaaaatccgggcccttcggtatat
gtggacgaactcggcaacaacagtatcaacctgaaggtcaggatctgggccccgtccgcc
ttctggtgggatgtgaggacggaccttttgtggaagatcttccaggccctgcgaaaagcc
gacatcgacattccattcccgcagctgacgctttggtacggccaggaaccgccgaaaccg
tcaaaggcgggcaagggaagcggtttcaccccgcaggaagttcttggaaaaagcgaggtc
tcccccgaaaacgccgtgaaggtgatcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system