KEGG   Methanocorpusculum labreanum: Mlab_1701Help
Entry
Mlab_1701         CDS       T00472                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mla  Methanocorpusculum labreanum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mlab_1701
   01230 Biosynthesis of amino acids
    Mlab_1701
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1701
  Energy metabolism
   00680 Methane metabolism
    Mlab_1701
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlab_1701
Enzymes [BR:mla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mlab_1701
Exosome [BR:mla04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mlab_1701
  Exosomal proteins of melanoma cells
   Mlab_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1735846..1736778)
Genome map
AA seq 310 aa AA seqDB search
MADNTTEILVGNAFLDTPLFGEITYGNLLAAILILVGTYVVAKVLSVIVMRVLAGKVEVS
NSTFLAKIVRWLTYFVGIVAASPFLHIDFSGLIVAGGILAFAISFASQSTLSNFVAGVLL
MFERPVGVGDNISVNGTEGYVEDIGILSTTIRTYSGIFVRIPNESMFTSDITNYVAHIAR
RFDYDIGIRYSDDADKAIKVIKGIIEKHPYALKNPGPSVYVDELGNNSINLKVRIWAPSA
FWWDVRTDLLWKIFQALRKADIDIPFPQLTLWYGQEPPKPSKAGKGSGFTPQEVLGKSEV
SPENAVKVIK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacaccaccgagatcctcgtcggcaatgcatttctggatactccgcttttt
ggggagatcacctacggcaatctgttagcggccatcctcattctggttgggacgtatgtc
gtggcaaaagtcctttccgtcattgttatgcgtgtccttgccggcaaagtcgaggtaagc
aacagtacgtttctcgcaaagatcgttcgatggttaacctacttcgtcggtatcgttgcg
gcaagtccttttctgcacatagacttctccgggctgatcgtcgctggaggaattctggcg
ttcgcgatcagttttgcgtcgcaaagcacgctttccaacttcgttgccggcgttctgctg
atgttcgagaggccggtaggagtcggcgacaatatcagtgtgaacggaaccgaaggctat
gtcgaggacataggcattttgtccacgacgatccgtacctacagtggtatcttcgtccgt
atcccgaatgagtcgatgttcacctccgatatcacgaattatgtggcacatatcgcccgg
cggttcgattatgatatcgggatcagatactcggatgatgcggataaagcgatcaaagtc
atcaaaggtatcatcgagaagcatccgtatgccctgaaaaatccgggcccttcggtatat
gtggacgaactcggcaacaacagtatcaacctgaaggtcaggatctgggccccgtccgcc
ttctggtgggatgtgaggacggaccttttgtggaagatcttccaggccctgcgaaaagcc
gacatcgacattccattcccgcagctgacgctttggtacggccaggaaccgccgaaaccg
tcaaaggcgggcaagggaagcggtttcaccccgcaggaagttcttggaaaaagcgaggtc
tcccccgaaaacgccgtgaaggtgatcaagtaa

DBGET integrated database retrieval system