KEGG   Methanocorpusculum labreanum: Mlab_1723Help
Entry
Mlab_1723         CDS       T00472                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00010  Glycolysis / Gluconeogenesis
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01120  Microbial metabolism in diverse environments
mla01130  Biosynthesis of antibiotics
mla01200  Carbon metabolism
mla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1723
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mlab_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C TrkA_N Sacchrp_dh_NADP GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABN07884
UniProt: A2SU78
Position
1770918..1771943
Genome map
AA seq 341 aa AA seqDB search
MIKVAVNGYGTIGKRVADAVSCQPDMEIIGVSKTKPGAEAYVAQKRGYPLYIADISKKDA
FTKAGIQVAGSVEEMIQKADIVVDATPGGVGEGNKALYEKYQKKAIWEGGEEHEVAGFSF
NASCNYEQAIGRQYARVVSCNTTGLCRIIKLIDSVFGVKKVRATMVRRGGDPGDIKRGPI
DAIVLNPVTIPSHHGPDVQSVLPNINIITSAMIVPTTLMHMHFINMELKNPATKEQVIEL
IKAHSRLGLIEKSTGITSTAQLKEFTSDLLRPRGDLWENGIFADSLSVLDGTDLYLFQAI
HQEADVVVETVDCIRAMAGDVKTAMESIAMTNKAVGLTAIR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggttgcagtcaatggatatggtacgatcggaaaacgcgttgccgacgcggtt
tcctgtcagccggatatggaaataatcggcgtttccaaaaccaaaccgggcgcagaggcc
tacgttgcccagaaaagaggataccccctctacatcgcagatatcagtaaaaaagacgct
ttcaccaaagcaggcatacaggtcgccggctcggtcgaggagatgatccagaaggcggat
atcgtcgtcgatgcaacgcccggaggagtcggtgagggaaacaaagccctctacgaaaag
taccagaaaaaagcgatctgggaaggaggagaggagcacgaagttgccggattttccttc
aacgcatcctgcaattacgagcaggcgatcggcagacagtatgcacgggtcgtgtcctgt
aataccaccggcctttgccggatcatcaaactcatcgactccgttttcggcgtgaaaaaa
gtccgggcaaccatggttcgccggggaggagaccccggggatatcaaacgaggaccgatc
gatgcgatcgttttgaacccggtcacgatcccgtcccaccacggtccggacgtgcagagc
gttctcccgaatatcaatatcataacctcggcgatgatcgtgccgacgacacttatgcat
atgcatttcatcaatatggaactgaaaaacccggcaaccaaagagcaggtcatcgagctg
atcaaagcccactcccgtctcggccttattgaaaagagcacggggatcacgagcacggcc
cagctgaaagagttcacctccgatctgctccgtccaagaggagacctctgggagaacggg
atctttgccgactcgctgtcggtcctcgacggaacggatctgtatttgttccaggcgatc
catcaggaagcggatgtcgtcgtggaaaccgtggactgtatccgggcaatggccggagat
gtgaagaccgccatggaatcgatcgcaatgacaaacaaggctgttggtctgacggccatc
cgctga

DBGET integrated database retrieval system