KEGG   Mycobacterium leprae Br4923: MLBr01158Help
Entry
MLBr01158         CDS       T00842                                 

Gene name
fadA4
Definition
(GenBank) possible acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MLBr01158 (fadA4)
   00630 Glyoxylate and dicarboxylate metabolism
    MLBr01158 (fadA4)
   00640 Propanoate metabolism
    MLBr01158 (fadA4)
   00650 Butanoate metabolism
    MLBr01158 (fadA4)
  Lipid metabolism
   00071 Fatty acid degradation
    MLBr01158 (fadA4)
   00072 Synthesis and degradation of ketone bodies
    MLBr01158 (fadA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MLBr01158 (fadA4)
   00310 Lysine degradation
    MLBr01158 (fadA4)
   00380 Tryptophan metabolism
    MLBr01158 (fadA4)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MLBr01158 (fadA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MLBr01158 (fadA4)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MLBr01158 (fadA4)
Enzymes [BR:mlb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MLBr01158 (fadA4)
Exosome [BR:mlb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MLBr01158 (fadA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1352952..1354133
Genome map
AA seq 393 aa AA seqDB search
MTTSVIVTGARTPIGKLMGSLKDFSASDLGAITIAAALKKANVAPSIVQYVIIGQVLTAG
AGQMPARQAAVAAGIGWDVPALTINKMCLSGLDAIALADQLIRAGEFDVVVAGGQESMTK
APHLLMDSRSGYKYGDVTIVDHLAYDGLHDVFTNQPMGALTEQRNDVEKFTRQEQDEFAA
RSHQKAAAAWKDGVFADEVVPVSIPQSKGDSLQFTEDEGIRANTSAESLAGLKPAFRCGG
TITPGSASQISDGAATVVVMNKEKAQQLGLTWLVEIGAHGVVAGPDSTLQSQPANAIKKA
VDREGISVEQLDVVEINEAFAAVALASARELGIAPELVNVNGGAIAVGHPLGMSGARITL
HVALELARRGSGYGVAALCGAGGQGDALILRAV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatcggtgatcgttactggagcacggacacccattggtaagttgatggggtct
ttgaaggacttttcggctagcgatttgggcgcgatcaccattgccgctgcgctgaagaaa
gccaatgtagcaccttccattgtgcagtacgtgattataggccaggtgttgaccgcgggg
gccggtcagatgccggcgcggcaggcggcagtagcggccggcatcggttgggatgtgccg
gcgctgacgattaacaagatgtgtctgtctggtcttgacgccatcgcactcgctgaccag
ctcattcgcgccggagaattcgatgtggtggtggctggcggccaagagtccatgacgaag
gcaccacatctgctgatggatagccggtcgggttacaagtacggtgacgttaccattgtg
gaccatttagcctatgacggcctgcacgatgtgttcaccaatcagccgatgggcgcgctt
accgaacagcgcaatgatgtcgaaaaattcacgcgccaagaacaggacgagtttgctgcc
cggtcgcaccaaaaggcggcagcggcatggaaggacggcgtcttcgccgacgaagtggtg
ccggtgagtattccgcagagcaaaggtgattcgctgcagttcactgaggatgaggggatt
cgcgccaacaccagtgccgagtctttggccggtctgaagccggcgtttcgctgcggcggc
actattactccaggctctgcgtcgcagatctccgatggtgcagccactgtcgtggtgatg
aacaaggaaaaggcgcagcagctggggttgacttggctggtcgagatcggtgcccacggc
gttgtagccggcccagattctacgttgcaatcccagccggccaacgcaatcaagaaggcg
gttgaccgtgaaggtatctccgtcgagcagctcgatgtcgtagagattaacgaggcgttc
gcggcggtggcgctggcctcagcccgtgaacttggtatcgcccccgagcttgtcaacgtc
aacggcggagcgatcgctgtcggtcaccccctcgggatgtcgggagccagaataacgttg
catgtcgcgctagaattggcgcgtcgcggttcgggttatggtgttgcggctctgtgcggt
gccggtggccagggtgatgcgctgattctgcgggccgtttag

DBGET integrated database retrieval system