KEGG   Mycobacterium leprae Br4923: MLBr_00223Help
Entry
MLBr_00223        CDS       T00842                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mlb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296097..296714
Genome map
AA seq 205 aa AA seqDB search
MALLDLGLESTAVPRIRVFDQQRAEAAIRELLYAIGEDPDREGLADTPARVARACRELFS
GLYTDPQTVLNTMFDEEHNELVIVKEIPMYSTCEHHLVSFHGVAHIGYLPGADGRVTGLS
KIARLVDLYAKRPQVQERLTSQIADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITT
TSAVRGQFKTDAASRAEALGLILRK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggccttactggatttagggctggaaagcaccgcggtcccgcgcatccgggtttttgac
cagcagcgtgccgaggccgcgattcgcgagttgctgtacgcgattggcgaggacccggat
agggagggtttggccgacaccccggctcgcgtggcccgcgcatgccgcgagctgttctct
gggctctacaccgacccgcaaactgtgctgaacaccatgttcgacgaagaacacaatgaa
ctggtgatcgtcaaagagattccgatgtactctacctgcgaacaccatttggtgtctttc
catggtgtggcgcacatcggctatcttccaggcgcggacggtagggtaaccgggctttcg
aagatcgctcggctagtggacctctacgccaaacggccacaagtgcaggagcggctcacc
agccagatcgccgacgccttggtcagcaagctcgatccacgcggggtcatcatcgtcgtc
gaggccgagcacctgtgcatggcaatgcgcggtgtccgcaagcctggcgcgatcacgacg
acgtcggcggtgcgcggtcagttcaaaactgatgctgcttctcgtgccgaagcgctcggc
ctcatcctgcgtaagtga

DBGET integrated database retrieval system