KEGG   Mycobacterium leprae Br4923: MLBr_00389Help
Entry
MLBr_00389        CDS       T00842                                 

Gene name
choD
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mlb00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483460..485169
Genome map
AA seq 569 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAKTSWDLRKFLWAPKL
GCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPFFANQQWAHITDWHSELAPHY
DQAQRMLGVVCNPTFTDADRILKEVVDEMGFGDTFVPTPVGVFFGPDGTQTPGRTVADPY
FGGVGPVRTGCLECGCCMTGCRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFELRSEGL
WEVHTVRTGSWLRRGRRTFTAAHLLLAAGTWGTQRLLFRMRDQGKLPRLSQRLGVLTRTN
SESIVGAGTLNVMPDRDLTHGVAITSSIHPTSDTHIEPIRYGKGSNAMGLLQTLMTDGPG
PEGTDVPRWRQLLHQASEDPRRMLRLINPRRWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGNGEPNPSWIPIGNEVTRRLAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGDN
AEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSIAAQAERAASLWPNKGQHDQRPR
QGESYRRLAPIAPDHPVVPAEAPGALRWL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattatgacgtcttaatcatcggttcagggtttggcggcagtgtcagtgcg
ctgcggctcacggaaaaaggttaccgggtcggtgttttggaggcgggccgtcgcttcgcc
gacgaggattttgccaagacgtcctgggatctgcgtaaattcctctgggcgccgaagctg
ggctgctacggcatccaacgcattcacctgctgcgcaacgtgatgatattggccggcgcc
ggagtgggaggcggttcgttgaactacgcgaatacgttgtacgttccgccggagccgttc
tttgccaaccagcagtgggcgcacatcaccgactggcacagcgagctggcgccgcattac
gaccaggcgcagcggatgttaggtgtggtttgtaacccgaccttcaccgacgccgaccgg
atactcaaagaggttgtcgatgagatggggtttggcgacacctttgtgccgacgccggtg
ggggtgtttttcggccctgatggcactcagacgccgggtcggaccgtggccgacccgtat
ttcggcggcgtggggccagtgcgcaccggctgcctggaatgtggttgctgtatgacgggt
tgtcgccacggtgccaagaacacgttggtgaaaaattaccttggtctagcggaatcagca
ggtgcgcaagtgattccgatgacgacggtgaaaggattcgaactgcggtccgaggggctg
tgggaagttcatacggtccgcaccggcagttggctgcgcaggggcagacgcacgtttacc
gctgcacacctgctgctggccgccggcacgtgggggacgcaacgtttgctgttcaggatg
cgtgaccaaggtaagttgcctcgtctgtcgcagcgcttgggtgtgttgactcggacaaac
tcggagtcgattgtcggtgctgggaccttgaacgtcatgcctgaccgggacctgacgcat
ggcgtggcgatcacgtcgtcgattcacccgacgtcggacacgcatatcgaacccatacgc
tacggcaaggggtccaacgcgatgggattgttgcagaccttgatgactgacgggcccggt
cccgagggcaccgatgtgccgcgctggaggcagttattgcatcaggccagcgaagatccg
cgccgcatgctgcggctgattaatccccgtcggtggagcgaacgcacggtgatcgcgttg
gtgatgcagcacttggataactcgatcaccacgtttaccaagcgggggaaactgggcatc
cgttggtactccagcaaacaggggaacggagaaccgaacccgtcgtggatcccgatcggc
aacgaggtcacccgccgtctagccgccaagatcgacggcgtggccggcggtacctggggc
gagcttttcaacatcccgctgaccgcgcactttcttggcggtgcggtgattggcgacaac
gctgaacacggggtgatagacccctaccatcgagtctacggctatcctacactgtacgtg
gtggacggcgcagcgatttcggcgaacctgggcgtcaacccatcgttgtctatcgctgcg
caagctgagcgtgcagcctccttgtggcccaacaagggccagcacgatcagcgccctcgg
cagggtgagtcgtaccgtcggctggccccgatcgccccggaccacccggtggtgcccgcc
gaagcgccgggagcgctgcggtggctatag

DBGET integrated database retrieval system