KEGG   Mycobacterium leprae Br4923: MLBr_00482Help
Entry
MLBr_00482        CDS       T00842                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mlb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
581796..582407
Genome map
AA seq 203 aa AA seqDB search
MIFSVRGEVLEVALDHAVIEAAGIGYRVNATPSALATLRQGSQARLVTAMVVREDSMTLY
GFSDAENRDLFLALLSVSGVGPRLAMATLAVHDAAALRQALADSDVASLTRVPGIGKRGA
ERIVLELRDKVGPVGASGLTVGTAADGNAVRGSVVEALVGLGFAAKQAEEATDQVLDGEL
GKDGAVATSSALRAALSLLGKTR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgattttctcggtacgcggcgaggtactcgaggtggcacttgaccacgccgtcatcgaa
gccgccggtatcggctatcgggtaaacgcgacgccgtcggcgttggcgacgttgcggcag
ggcagccaggcccgactggtcaccgcaatggtcgtgcgcgaggactcgatgacgttgtac
gggttttctgatgccgagaaccgtgacctattcctagcgctgctgtcagtctcgggagtt
gggcctcgccttgccatggcgacattggccgtgcacgacgctgcggcgcttcggcaggca
ctggccgatagtgatgtcgcctcgctgacccgggtgcccggtatcggcaagcgtggtgcc
gaacggatagtgctggagttacgcgacaaggttggcccggtaggggcgtctggattgact
gtgggtactgctgctgacggcaacgcggtgcgaggttctgtggtcgaagccctggtaggg
ctgggttttgcggccaagcaggccgaggaagcgaccgaccaggtgctcgacggtgaactt
ggaaaagatggggcggtggcaacgtccagcgccttgcgggctgctctgtcgttgctgggc
aagacccgatga

DBGET integrated database retrieval system