KEGG   Mycobacterium leprae Br4923: MLBr_00532Help
Entry
MLBr_00532        CDS       T00842                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MLBr_00532 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MLBr_00532 (pyrB)
Enzymes [BR:mlb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MLBr_00532 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645590..646555
Genome map
AA seq 321 aa AA seqDB search
MMRRHLLNAGDLSRDDAIAIFDDADRFAHALVGREIKKLPTLRGRTVITMFYENSTRTRV
SFEVAGKWMSANVINVSPAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLADW
TAAETGEDGPAVINAGDGTHEHPTQALLDALTIRQRLGSIEGRRILIVGDILHSRVARSN
VVLLDTLGAEVVLVAPRTLLPIGVDGWPATVSCDFDAELPAADAVLMLRVQAERMNGGFF
PSVREYSCLYGLTERRQALLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHV
RMAVLFHVLVGTQSAEEEGAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgcagacatctgctgaacgccggtgatttgagccgcgacgatgccatcgccatc
ttcgacgatgccgaccggttcgcgcatgctctggtgggtcgcgagatcaagaagctgccg
acgctacgaggtcgcacggtaatcacgatgttctacgaaaattcgactcgcacccgcgtg
tcgttcgaggtggccggcaagtggatgagcgccaatgtgatcaacgtcagcccggctgga
tcgtcggtgggtaagggcgaatcgttgcgtgacaccgcgctgacactgcgtgcggccggt
gctgacgcgttgattatccggcacccggcttccggtgctgcccatctgcttgccgattgg
actgctgctgagaccggcgaggatggtccggcggtgatcaacgccggcgacggcactcat
gagcacccgacccaggcgctgctggacgcgctcaccatccgtcagcggctcggtagcatt
gaaggccggcgcatcttgatcgtcggcgacatcttgcacagccgggttgcgcggtccaac
gtcgtgctgctagacaccctgggtgctgaggtggtgctggtggcgccgcggactttgttg
ccgattggggttgacggctggccagccaccgtctcatgcgactttgacgctgaactgcct
gccgccgatgcggtgctgatgctgcgagtacaggccgaacggatgaatggcgggtttttc
ccgtcggtacgcgagtattcttgtctctacgggctaaccgagcggcgccaggcactgttg
cccggccatgcagtggtgctgcacccagggccgatgctacgtggcatggagatcgcctct
tctgttgctgactcgtcgcaatcagctgttttgcaacaggtttccaacggtgtgcatgtg
cggatggcagtgcttttccatgttctggttgggacccagtcggccgaagaagagggtgcg
gcatga

DBGET integrated database retrieval system