KEGG   Mycobacterium leprae Br4923: MLBr_01044Help
Entry
MLBr_01044        CDS       T00842                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MLBr_01044 (hemY)
Enzymes [BR:mlb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MLBr_01044 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209327..1210682
Genome map
AA seq 451 aa AA seqDB search
MTSRSYCVVGGGISGLTAAYRLRVATGDDVAITLFDPGDRLGGVLRTECVGGQPMDLGAE
AFLLRRPEVPALLAELGLSERQRATTDARPLIYSQQRLHSLPPDTVAGIPSSATSVAGLV
DDATVARIGAEAVRPLSWEPGSDPAMAELVADRFGEQAVARLVDPLLGGVYAGSAATIGL
RAGAPSVAAALDCGATSLMEAVRQGLPPVAAGPVFGALDGGYQVLIDELVRRSRLQWVAA
TVVGLDRGTCGWTLVDDTGACWSADGVILAVPAPRLVRLLQQIAPRTVAAASRIVSASSA
VVALSVPRDTTFPQNSGVLVASGERLRAKAVTLSSRKWGLQGDTQLVRLSFGKFGDQVAS
TASDDELLAWAVSDLAAVFDVTVDPVDVCVQRWIDAMPQYGPGHADLVAEVRAGLPPTLV
VAGSHMDGIGVPACISAAGRAIEALQAEVAR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgctcgtattgtgttgtgggtggcggaatctcgggacttacggcggcatat
cggttaagggtggctacgggtgacgatgttgctatcactttgttcgatcctggtgaccga
ctcggcggggtgttgcgcaccgagtgcgtaggcggacagccgatggacttgggcgccgag
gcattcttgctgcgccgtcccgaggtgccggcgttgctggccgagttgggtttgtcagag
cgccaacgcgccaccaccgatgcccgaccattgatctacagccagcaacggctgcattcg
ttgccaccggacaccgtcgccggcattccgtcctcggcgacgtcggtggccggcttggtc
gacgacgccacagttgcgcgtatcggcgccgaagctgtccgtccgctgagctgggaaccc
ggcagcgatcccgcgatggccgaattagtggccgaccggttcggcgagcaggccgtggcc
cggttggtggacccgctgttgggcggcgtctatgctggctcggcagcgacgatcgggctg
cgcgcgggcgccccgagtgtggcggctgccctcgactgcggggccaccagtttgatggag
gcggttcgacaggggttgccgccggtagcggccgggccggtttttggagcgctagacggc
ggctaccaggtgctgatcgacgagctcgtccgccgcagccgactgcagtgggtagctgcc
accgtggtagggctcgatcgtgggacttgcggttggacgctagtggacgacaccggtgct
tgctggtccgccgacggggttatcctggccgttcccgccccacggctcgtgcgcctgttg
cagcagatcgccccccgaacagtcgccgccgcaagccggatcgtgagtgcctcgtcggcg
gtggtggcactgtcggtgccccgggacaccacattcccgcagaattccggtgtgttggtg
gctagcggcgagcggctgcgagctaaagcggtcacgttgtcctcacgaaagtgggggctt
caaggggacacacagttggtgcggctttcgttcgggaagtttggtgatcaggtggcctcg
actgcctcggacgatgagctgctggcttgggcggtgtccgacctggccgcggtattcgat
gtgaccgtcgaccccgtcgatgtatgcgtgcagcggtggatcgacgcaatgccgcagtat
ggccccggtcacgccgatctggtcgccgaggtgcgcgccggcttgccgccgacgctggtc
gtggctggcagccatatggacggtattggtgtgcctgcgtgtatcagcgctgccgggcgc
gcgatcgaggccctccaagcggaagtggcacgataa

DBGET integrated database retrieval system