KEGG   Mycobacterium leprae Br4923: MLBr_01059Help
Entry
MLBr_01059        CDS       T00842                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mlb01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mlb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1223740..1224804
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIELTAALVDIPSESRAEARIADAVETALRAQTAGFEIVRNGNAVLARTSLHR
PARVLLAGHLDTVPVAGNLPSRCEKDVLHGCGTVDMKSGDAVFLHLAATVTEPVHDLTLM
FYDCEEIDSAANGLVRIERELPEWLAADVAILGEPTGGYIEAGCQGTLRVVINAAGSRAH
SARSWLGDNAIHKLGAVLDRLAAYRARTVDIDGCVYREGLSAVRVDGGVAGNVIPDAASV
TVNYRFAPDRSVAAALRHVHDVFDGLDVQIEQTDAAVGALPGLSQPAAKALVEAADGQVR
AKYGWTDVSRFAALGVPAVNYGPGDPNLAHRHDERVPVVQITAAVDMLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggatttgcgcggggacccgattgagctgaccgcggcgctcgtcgacatccccagc
gagtcacgggctgaagcacgcatcgctgatgcggtggagactgcgctgcgggcccagacc
gccggcttcgagattgttcgtaacggcaacgctgtgttggcgcgcacctcgttgcaccgg
ccggcgcgggtgctgctagccgggcacctagacaccgttccggtggccggaaacctgcct
agccgctgcgagaaggacgtgctacacggctgcggcaccgtggatatgaaatccggtgat
gcggttttcctacacttggcggccaccgtgaccgagccggtgcatgacttgacgttgatg
ttctacgactgtgaagaaatcgattctgcagcaaatggtttggttcgcatcgagcgggag
ctgccggagtggctcgccgctgacgtggccatcctgggtgagcccaccggcggctatatc
gaggccggctgccaggggacgctgcgcgttgtgattaatgcggctggatcccgtgcgcat
tctgcacgttcctggttgggcgacaacgcaatccataaactgggtgctgtgctggaccgg
ttggctgcatatcgggcgcgtaccgtcgacatcgatggatgtgtctaccgcgagggtcta
tctgctgtgcgcgtcgacggcggtgtggccggaaatgtgattcccgatgcggcctcagtg
acagtcaattaccgctttgctcctgaccgttcggtggccgcggcgttgcgccatgtgcac
gacgtgttcgatgggctcgacgtacagatcgagcagaccgacgcggcggtgggtgcgctg
cctggcctgtcgcagccggccgccaaggccttggtcgaggccgctgacgggcaggtccgt
gcgaaatacggttggacggatgtgtcacgattcgccgcgctgggtgtcccggcggttaac
tacggccctggtgaccccaacctggcgcaccggcacgacgaacgcgtgccggtcgtccag
atcaccgctgctgtggatatgttgcgtcgatacctcggcggctga

DBGET integrated database retrieval system