KEGG   Mycobacterium leprae Br4923: MLBr_01130Help
Entry
MLBr_01130        CDS       T00842                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MLBr_01130 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLBr_01130 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MLBr_01130 (thrC)
Enzymes [BR:mlb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MLBr_01130 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1321004..1322086
Genome map
AA seq 360 aa AA seqDB search
MSGQQTTTHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAAPRLSEQTGCTIHLKVE
GLNPTGSFKDRGMTMAVTDALARGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPMISLVNSVNPVRIEGQKTAVFEI
VDALGTAPHVHALPVGNAGNITAYWKGYTEYHADGLIDRLPRMLGTQAAGAAPLVLGEPV
SHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAATDEEILAAYHLVARAEGVFVEPASA
ASIAGLLKAIDGGWVARGSTVVCTITGNGLKDPDTALKDMPSVSPVPVDAVAVVEQLGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggccagcagacgaccacccaccagccttggccgggtgtgatcgcagcgtaccga
gaccgactaccagtgggcgacgattggaccccggttaccttgctagaaggtggcacgccg
ctcattgctgcgcccagactctccgaacagactggctgcacgattcacctcaaggtagag
ggcctcaaccccaccggctccttcaaagacaggggcatgacgatggcggtgaccgatgca
ctggcccgcgggcaacgtgccgtgttatgcgcgtcgacgggaaacacctcggcgtcggcg
gcggcatacgctgcccgcgccggtattacctgtgcggtgctaattccgcagggtaaaatt
gcgatgggcaagctcgcacaggcggtcatgcatggagccaagatcattcagatcgacggc
aacttcgacgattgcctggaactggctcgtaaaatggctgctgatttcccgatgatctcg
ttggtcaactcggttaacccggtgcgaatcgaaggtcaaaagacagcggtgttcgagatc
gttgacgcgctaggcaccgcaccacacgtgcatgcccttccggtcggcaacgctgggaac
atcactgcgtactggaaaggatacaccgaatatcacgctgatggtctgatcgacagactg
cctaggatgttgggtactcaggccgcgggcgcggctcccctggtactcggcgagcctgtg
agccatcccgaaaccatcgctactgcgatccgcattggctcgccggcgtcatggacgtcg
gctgtcgaagcccagcagcaatccaagggacgattcctggccgcgacggatgaggagatt
ctggctgcataccatctggtggcacgtgctgaaggcgtcttcgtcgaacccgcatcggcg
gccagcatcgccggcctcctcaaggccatcgatggtggctgggtggctcgtgggtcaacg
gtggtgtgtacgataaccggcaacggtctgaaggatcccgacacggcgttgaaggatatg
ccgagcgtctccccagtgcctgtcgatgcggtcgctgttgtcgagcagttagggctggtc
tag

DBGET integrated database retrieval system