KEGG   Mycobacterium leprae Br4923: MLBr_01273Help
Entry
MLBr_01273        CDS       T00842                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MLBr_01273 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLBr_01273 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MLBr_01273 (trpA)
Enzymes [BR:mlb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MLBr_01273 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1516656..1517468
Genome map
AA seq 270 aa AA seqDB search
MMVLEQSETSRLGPVFDSCRADNRAALIGYLPTGYPDVPTSVDAMIELVESGCDIIEVGV
PYSDPGMDGPTIARATEVALRGGVRVRDTLAAVEAISQAGGRAVVMTYWNPVLRYGVCAF
ARDLESAGGHGLVTPDLIPDEARQWIAASEKHRLDRIFLVAPSSTPHRLVTTVGASRGFV
YAVSVMGVTGARDAVSQVVPELVARVKAVSDIAVGVGLGVRSREQAAQIGGYADGVIVGS
ALVSALGDGLPRLRALAEELAAGVRQRTFM
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatggttctggaacagagcgaaacaagtaggcttgggccggttttcgattcgtgtcgt
gcggacaatcgcgcggcattgattggttacttgcccaccggttaccctgatgtgcctact
tcggtggacgcgatgatagaactcgtcgaatccggctgtgacatcattgaagttggcgtt
ccttattcggatcccggtatggacggtccaaccatcgcgagggccaccgaggttgcgctt
cgtggaggagtacgagtccgcgatactctagccgcggtcgaggcgatcagccaagctggc
ggacgcgccgtggtgatgacgtactggaatcctgtgttgcgctatggggtttgtgcgttt
gcgcgggatctggagtcagctggaggacacggtctggtcactcccgaccttattcccgac
gaagcacgccaatggatcgcggcatccgagaagcatcggttggatcgcatttttctagtg
gctccatcatcgacgccgcaccggttggtgaccacggtcggggcatcacgtggatttgtt
tatgcggtgtctgtgatgggtgtgaccggggcgcgtgacgcggtgtcgcaggttgtgcca
gaactggtggccagggtgaaggcagtatctgacattgcggtcggggtcggcctgggggtg
cgatcacgagagcaggccgcgcagatcggcggctacgccgacggtgtcattgttggttcc
gcgttggtgtcggcgctgggtgacggtttgcctcgattgcgtgctcttgccgaggaactc
gccgccggcgtgcgccaaaggacgttcatgtga

DBGET integrated database retrieval system