KEGG   Mycobacterium leprae Br4923: MLBr_01301Help
Entry
MLBr_01301        CDS       T00842                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mlb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549242..1550057
Genome map
AA seq 271 aa AA seqDB search
MASHDKRDYQAELTDAALAADLATAAGELLLEIREEIGFDQPRALGDAGDRLANSLLLSR
LRAERPGDAVLSEEAHDDRVRLQAGRVWIIDPLDGTREFSTAGRTDWAVHIALWQRTTGG
VADGRREITDAAVALPARGNRVYRSDTVTAGAVTGGVPNILRIAVSATRPPTILHRIRQK
LAIEPVAIGSAGAKAMAVVDGDVDAYLHVGGQWEWDSAAPAGVVLAAGMHASRLDGSPLR
YNQLDPYLPDFVMCRADIAPILLGVIREVWQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccatgacaaaagggattaccaggcagagttaacggatgctgcactggctgcc
gatctcgccacggcagcgggggagttactcctcgaaattcgcgaggagatcggtttcgac
caaccgcgggcgctcggcgatgctggtgacaggctggcaaattccctgctgctgagccgg
ctgcgggccgagcgcccgggtgatgcggtactcagcgaggaagcacatgatgatcgtgtt
cggctgcaggctggccgggtatggatcatcgacccactggatggtacccgcgaattctcc
acagcggggcgcactgactgggcggtacatatagcgctgtggcaacgtaccaccggcggc
gtcgcagacggccggcgcgagatcactgatgcggcggtggcgctgccggcccgcggtaac
agggtgtaccgcagtgacaccgtgaccgccggcgctgtgactggtggtgttcccaacatt
ctccggattgctgtcagcgccacccggccgcccacaatcttgcaccggatacggcaaaag
ttggccatcgaaccggtggctatcgggtcggcgggggctaaagcgatggcggttgtcgac
ggcgatgtggacgcctacctgcatgtcgggggccaatgggaatgggattcggcagcgcca
gccggggtggtgttggcagccggtatgcacgcatcgcgcctggacggctcgccgctgcgt
tacaaccagctcgatccgtatctacccgactttgttatgtgtcgcgccgatatcgcgccg
atactgctcggtgtcatccgtgaggtgtggcaatga

DBGET integrated database retrieval system