KEGG   Mycobacterium leprae Br4923: MLBr_01583Help
Entry
MLBr_01583        CDS       T00842                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mlb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1908140..1909360)
Genome map
AA seq 406 aa AA seqDB search
MNNPIEGHAGGRLRVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGGAQLDTLLRQRAA
TGVTNIAIADDRAAQLAGDIPYHGTDAVTRLVEETEADVVLNALVGALGLRPTLAALHTG
ARLALANKESLVAGGSLVLAAAQPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWNAGDLERVTPEQAGVHPTWSMGTMNTLNSASLVNKGLELIEANLLFGIPYDRIEVV
VHPQSIVHSMVTFIDGSTIAQASPPDMKLPISLALGWPQRVGGAARACAFTTASTWEFEP
LDIDVFPAVELARHAGQIGGCMTAIYDAANEEAAEAFLQGRIGFPAIVATIADVLQRADQ
WAPQWGEGPATVDDVLDAQRWARERALCAVATASSGKVSDMVLERS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatccgatcgaggggcacgctggcggccgcctccgcgtgctggtgttgggaagt
actggctcaattggcacccaggcgctggaagttatcgccgccaatccggaccgtttcgag
gtagtcgggctggccgccgggggcgcgcagctggacacgctgctgaggcagcgcgccgcg
accggcgtcaccaatatcgccatcgctgacgatcgcgcggctcagctggccggcgacatc
ccttaccacgggaccgatgcggtcacccggctggttgaggagactgaggctgacgttgtc
ctcaatgcgctggtcggggcattgggtctgcgacccacactggctgcactgcacacgggc
gcgcgattggcgttggccaacaaggaatcgctggtagctggcggttcgctggtgttggcc
gcggcgcagccaggccagatcgtgcccgtagactcggaacactccgcgctggcgcaatgc
ctgcgcggtggtacccccgacgaagttgctaagttagtgctaaccgcctccggcgggccg
tttcgtggctggaacgccggcgacttggagcgcgttacacccgagcaggcgggcgtccat
ccgacttggtcaatggggacgatgaacacgctgaactcagcgtctctggttaacaagggg
ctcgagctcatcgaagccaacctgttgttcggcattccctacgaccgcattgaggtggtt
gtgcaccctcagtcaattgttcattcgatggtgacattcatcgacggctcgacgatcgcc
caagccagccctccggacatgaagctacctatttctttggcgttgggctggccacagcgg
gtgggtggcgctgctcgagcctgtgctttcactaccgcatctacctgggaattcgagccg
ctggacatcgatgtttttcccgcagtcgagctggcccggcacgctggacagatcggcggc
tgtatgaccgccatttacgatgctgctaatgaggaggctgcagaggccttcctccaaggt
cggatcggcttccccgccatcgtcgcaacaatcgcggatgtgttgcagcgtgccgaccaa
tgggctccccaatggggtgagggacccgctactgtggatgatgtactcgacgcgcagcgc
tgggcccgtgagcgagcgttgtgtgcggtagcaacagcgagttctggaaaggtctctgac
atggtcttagaaaggtcctaa

DBGET integrated database retrieval system