KEGG   Mycobacterium leprae Br4923: MLBr_01701Help
Entry
MLBr_01701        CDS       T00842                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLBr_01701 (pfkA)
   01230 Biosynthesis of amino acids
    MLBr_01701 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLBr_01701 (pfkA)
   00030 Pentose phosphate pathway
    MLBr_01701 (pfkA)
   00051 Fructose and mannose metabolism
    MLBr_01701 (pfkA)
   00052 Galactose metabolism
    MLBr_01701 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MLBr_01701 (pfkA)
Enzymes [BR:mlb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MLBr_01701 (pfkA)
Protein phosphatases and associated proteins [BR:mlb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MLBr_01701 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2051925..2052956)
Genome map
AA seq 343 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAIVRTCDARYGSSVVGFQDGWRGLLENRRMQLCNDDRNDR
LLAKGGTMLGTAHVHPDKLRAGLHQIKQTLDDNGIDVLIPIGGEGTLTAAHWLSQEDVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALS
SGLASGAHMTLIPEQPFDVEEVCCLVKRRFQRGDSHFICVVAEGAKPVPGSITLRQGGMD
EFGHERFTGVAAQLGAEVEKRINKDVRVTVLGHVQRGGTPTAFDRVLATRFGVNAADASH
AGEYGQMVSLRGQDIGRVPLEDAVRQLKLVPESRYDDAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcggaattctcacggggggcggcgactgtcctggtcttaacgccgttatccgg
gcgattgtgcgcacctgtgacgcccggtacggttcgtcggtagtcgggtttcaggacggc
tggcgtgggttgctggagaatcggcgcatgcagctgtgcaacgacgaccggaatgaccgt
ctgttagccaaaggcggaaccatgctgggcactgcccacgtgcaccccgacaagctgcgg
gccgggctgcatcagatcaagcagaccctggatgacaatggcatcgacgtgctcatcccg
atcggcggcgaaggcacgctgacggccgcgcactggctgtcgcaggaagacgttcctgtg
gtcggcgtgccgaagacgatcgacaacgacatcgactgcaccgacgtgacctttggccac
gacaccgcgctgacggtggctaccgaagccattgaccggttgcacagtaccgccgaatct
caccaacgtgtgatgctggtggaggtgatgggtcggcatgccggctggatagcgctgagt
tccgggctggcttccggtgcgcacatgacgctgattcccgaacagcccttcgatgtcgag
gaagtgtgctgcctcgtgaaacgacgttttcagcgcggggattcgcatttcatttgcgtg
gtcgctgagggtgccaagccggtcccaggctcgatcacgttgcgccaaggtgggatggat
gaatttggtcacgagcgtttcactggggtggcagcgcaattgggcgctgaggtcgagaag
cggatcaacaaggacgtgcgagtgactgtgctgggtcatgtccaacgcggtggtacaccg
acggccttcgatcgggtgctggccacccggttcggggttaatgctgccgacgcctcgcac
gccggcgagtacggccagatggtgtcactgcgtgggcaagacatcggtcgcgtaccgctg
gaggatgcggtgcgtcagctcaaattggtgcccgaaagccgttacgacgacgccgccgcc
ttcttcggttaa

DBGET integrated database retrieval system