KEGG   Mycobacterium leprae Br4923: MLBr_01714Help
Entry
MLBr_01714        CDS       T00842                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mlb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2066874..2068442
Genome map
AA seq 522 aa AA seqDB search
MNTSANPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQVLHTLADENRH
RLITLGVTPVVNAQLDDPYCLDGMHHWLANWRLRATEAASVRSGSESKPACAPQALRAFG
ARECIEAQRALEYFATLWRHGGSPLLRSLIDAGTVELLGGPLAHPFQPLIAPRLREFALH
EGLDDAWLRLAHRPTGIWAPECAYAPGMEHDYSAAGITHFMVDGPSLHGDTALGRPVGDT
AVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGCNVPSEAKAPYDP
DHADKVVDAHVDDFVGVVRNRLFTESERIGRPAHVVAAFDTELFGHWWYEGPIWLQRVLR
ALPTAGVRVGTLSDALAGGFVGNTVTLPPSSWGSGKDWQVWAGDKVADLVQLNNEVVDTA
LTTVDKVLAQTTSLDGLLPRNHVADQLLRETLLTVSSDWPFMVSKDSAADYARYRAHLHA
HATREIAGALASGRRDTAAQLADGWNRADGLFGALDARRLPR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatccgcaaacccagtgcccggtctgttcaccctggtgctacacacccacttg
ccgtggctagcccaccacggccgctggccggtcggtgaggaatggctctaccaatcgtgg
gccgcggcctacctgccgctgctgcaggtgcttcacaccctagccgatgaaaatcggcac
cggctgattacactcggggttacgccggtggtgaacgctcaactcgacgacccctattgt
ctcgacggtatgcatcactggctggcgaactggcgactgcgcgcgactgaagcggccagc
gtgcggtccggttcggagtcgaagccggcgtgcgcaccgcaagcattgcgggccttcgga
gctcgcgaatgcatcgaggcccagcgggcactcgagtatttcgctactctgtggcgtcac
ggcggcagcccgctactgcgcagcctaatcgacgccgggacggtcgaactgcttggcggc
ccgttggcccacccattccaaccgcttatcgcgccgcggctgcgcgagttcgcgctacac
gaaggcctggatgacgcgtggctgcggctggcgcaccggccaaccggcatatgggcgccg
gaatgcgcctacgccccagggatggaacacgactactcggccgcgggcatcactcacttc
atggtcgacggtccgtcactgcacggcgacaccgcactgggccgaccagttggcgacacc
gccgtggtcgcgttcgggcgtgacttgcaggtcagctaccgggtgtggtcgccgaaatct
ggctatccgggacatgccgcctaccgcgatttccacacctacgaccacctcaccggtctc
aaaccggccagagtcaccgggtgcaacgtgccgtctgaggccaaggcgccctacgatccc
gaccacgccgacaaagtcgtcgacgcccatgtagacgactttgtcggcgtggtccgcaac
cggctcttcaccgagtccgagcgcatcgggcggcccgctcacgtggtcgccgccttcgat
actgagttgttcggccattggtggtacgaggggccgatctggctgcagcgggtgctgcgc
gccttgcccaccgccggggtgcgagtgggcacacttagcgacgccctagcgggcgggttc
gtcggcaatacagttacgttgccacccagctcgtgggggtccggtaaggactggcaagtg
tgggccggcgacaaagtcgctgatctggttcagctcaacaatgaggtagtcgacacagcg
ctgaccacagtcgataaagtgctagcacagacgacatcactggatggacttctccctcgc
aatcacgtcgccgaccaactcctgcgcgaaacgctgctcaccgtatcaagtgactggcca
ttcatggtgagcaaggattcagccgccgactacgccaggtaccgtgcccacctgcatgcc
cacgccacacgggagatcgcgggagcgctggcatcgggccgacgtgacaccgcggcgcaa
ctggcggacggatggaaccgcgccgacggtctgttcggcgcactggacgcccgaaggctg
ccccggtga

DBGET integrated database retrieval system