KEGG   Mycobacterium leprae Br4923: MLBr_01715Help
Entry
MLBr_01715        CDS       T00842                                 

Definition
transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MLBr_01715
Enzymes [BR:mlb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MLBr_01715
Glycosyltransferases [BR:mlb01003]
 Polysaccharide
  Storage polysaccharide
   MLBr_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2068468..2069784
Genome map
AA seq 438 aa AA seqDB search
MFIQRHAVVRGIFGTFAPAEGTTLMKILIVSWEYPPVVIGGLGRHVHHLSTALAAAGHDV
VVLSRRPSGTDPCTHPTSDEISEGVRVIAAAQDPHEFTFSNDMMAWTLAMGHAMIRTGLS
LTRHSSDLPWRPDVVHAHDWLVAHPAITLAQFYDVPMVSTIHATEAGRHSGWVSGALSRQ
VHAVESWLVRESDSLITCSASMCNEIIELFGPGLAEITVIRNGIDPARWPFAARRARTGP
AELLYVGRLEYEKGVHDVIAALPRIRRSYPGTTLTIAGEGTQQDWLVDQARKYKVIKATR
FVGHLNHNELLAALQRADAAVLPSHYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQT
GVSCPPRDIAELAAMVCTVLEDPDAAQQRALAARERLTSDFDWQTVAQQTAQVYLAAKRR
ERQPQPRLPIVEHALPDR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatacagcgacacgccgtcgtgcgtggcatttttgggacgttcgcgccagcggag
gggacaacgctcatgaaaatcctgatagtgtcctgggaatatccgccagtggtgatcggc
gggctcggccgtcacgtccatcacctatcgactgcactggccgcggccggccacgacgtg
gttgtcctgtctcgccgcccctcgggcaccgatccctgtacccatccgacctccgacgag
atcagcgaaggtgtgcgagtgatcgctgccgcacaggatccacacgagttcaccttcagt
aacgacatgatggcttggactctggcgatgggccatgcgatgatccgcaccggcctgtcc
ctaaccaggcatagcagcgacctcccctggcgtcccgatgtcgtacatgcgcacgactgg
ctggtggcacatccagccataacgctcgcccaattctatgatgttccaatggtttccacg
attcacgcgacagaagcaggtcggcattccggctgggtatctggagcactcagccgtcag
gtacatgccgtcgagtcgtggctggtacgtgaatccgattcgttgatcacatgttcggca
tcgatgtgcaacgaaatcatcgaattgtttggtcccggtctggccgagatcacagtgatc
cgcaacggtattgacccagcacgctggccgttcgcagcccgccgggcgcgcactggaccg
gccgaactactctacgtcgggcgactagaatatgagaagggtgtgcacgacgtcattgcc
gcgctaccccggataaggcgcagctaccctggcaccacgttgaccatcgctggagaagga
acccagcaggattggctcgtcgaccaagcccgtaaatacaaagtaatcaaagccacccgg
ttcgtcgggcacctcaaccacaacgaactgctggcggcgctgcagcgggccgacgccgca
gtgctgccgagtcactatgagccgttcggactggtcgccctagaggccgctgcagccggc
actccgctggtgacctcaaacataggcggcctgggcgaggcggtaatcaacgggcagacc
ggggtgtcgtgtccgccccgcgatatcgcagaactggctgcgatggtgtgcacagtactt
gaggatcccgacgccgcgcaacaacgcgcgctagctgcccgagagcgtctcacctccgat
ttcgattggcagacagtagctcagcagaccgcgcaagtgtacctggcggccaagcgtcgc
gaacgacaaccacaacccaggttgcccatcgtcgaacacgcattaccggatcgctag

DBGET integrated database retrieval system