KEGG   Mycobacterium leprae Br4923: MLBr_02011Help
Entry
MLBr_02011        CDS       T00842                                 

Gene name
aao
Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mlb00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mlb00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:mlb00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2403414..2404376
Genome map
AA seq 320 aa AA seqDB search
MASNGQQIVVIGAGVSGLTSAVCLAEAGWPVQLWAAAMPQQTTSAVAGAVWAPPRPEERA
STSLAWTGHSLQIFRELANDPSTGVRMAPALTVGDLPGANAMGLAAKLIPDLRPADLADL
PDGFGAGFFGTMPMIDMPQYLDYLTARLAAAGCELETRSVRSLAEAADTAPIIVNCTGLG
AAALANDDTVRPLFGQHVVLTNPGLQQLFLEVNNGSEWICYFPHPLRVVCGGISIPGRWD
TTPDPAVTDRILQRCRRIEPRLGEAAVIETITGLRPDRPSPRVEVELSGSVRYIHNYGHS
SSGVTLSWGCARDVVRLVSD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaacgggcaacaaattgtcgtcattggtgccggcgtgagtggcttaacatcg
gccgtctgtctggccgaagcgggatggccggtgcagctgtgggctgccgcaatgccacag
cagacgacctccgcggtggcgggggcggtatgggcaccgccacggccagaggaacgtgcc
tctacatcgctggcttggacaggacactcactgcagatatttcgtgaactggctaacgac
cccagcaccggggtgcgtatggcgccagcgttgaccgttggcgatttacccggggcgaac
gcgatggggcttgctgccaagctgatccccgacctgcggccggcggacctggccgatctc
cctgacggcttcggtgccgggtttttcggcaccatgccaatgatcgatatgccccaatac
ctcgattacctgacagcgcgactggcggcagccggctgcgaactcgaaactcgttcagta
cggtcgctagctgaggccgcagacactgcaccgataattgttaactgcactggtctcggc
gcagcagccctcgcgaacgatgacacggtgcgtccattgtttggtcaacacgtagtcctc
acaaatcccggtctgcagcaactctttttggaagtcaataacggttcggaatggatctgc
tacttcccccaccctctgcgcgtggtgtgcggcggcatcagtatccccggccgctgggat
accaccccagaccccgcggtgactgaccgaatcctgcaacgctgccgaagaatcgaacca
cggctcggcgaggccgcggtgatcgagacaattaccgggttgcggccagaccgtccgtcg
ccgcgggtggaggttgagctgagtgggtccgtgcggtacatccacaactacggccacagc
agcagcggcgtgaccttatcgtgggggtgcgcacgcgacgtggtgcgccttgtcagcgac
tga

DBGET integrated database retrieval system