KEGG   Mycobacterium leprae Br4923: MLBr_02069Help
Entry
MLBr_02069        CDS       T00842                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLBr_02069 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MLBr_02069 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MLBr_02069 (glcB)
Enzymes [BR:mlb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MLBr_02069 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2457921..2460116
Genome map
AA seq 731 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDEL
QAQIDKWHRHRVIEPFDVDAYRQFLIDIGYLLPEPDDFTISTSGVDDEITMTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVIAYARKFMDQAV
PLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHI
EVLIDPESPIGKTDPVGIKDVILESAITTIMDFEDSVTAVDADDKVRGYRNWLGLNKGDL
TEEVNKDGKTFTRVLNADRSYTTPDGGELTLPGRSLLFVRNVGHLTTSDAILVDGGDGQE
KEVFEGIIDAVFTGLAAIHGLKTGEANGPLTNSRTGSIYIVKPKMHGPAEVAFTCELFSR
VEDVLGLPQGTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAG
PMIRKGAMKNSTWIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKA
GATTAWVPSPTAATLHAMHYHQVDVAAVQQELTGQRRATVDQLLTIPLAKELAWAPEEIR
EEVDNDCQSILGYVVRWVDQGIGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITS
EDVRASLERMAPLVDQQNAEDPAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILH
RRRREFKAQNR
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcgtgtcggcggggaatttgcgcgtcgcccgtgtgctttacgacttcgtc
aacaacgaagccctgcctggcaccgacatcaacccaaacagcttctggtcgggcgtcgcc
aaggtcgtcgccgacctcaccccgcaaaaccaaagtttgctgaactcccgcgatgagctg
caggcccagattgacaaatggcaccgccatcgtgtgatcgagccattcgacgtggatgct
tatcggcagttcctcatcgatatcggctatctgctgcctgaacccgatgacttcaccatc
agcacctcaggagtagacgacgagatcaccatgaccgccggcccgcagctggtggtgccg
gtacttaacgcacggttcgcactcaacgccgccaacgcccgctggggctccctttacgac
gctctatatggcaccgacaccataccggaaaccgagggagccgaaaagggctctgagtac
aacaagattcgcggcgacaaggtgatcgcctacgcacgcaagtttatggatcaggccgtc
ccgctggcttctgactcatggactaacgctacgggagtgagcatcttcgacggccagctt
cagatcgccatcggcacgaattccaccggattagccagtcccgaaaagtttgtcggctac
aatcgccagttgcgatcctccaactggtcggtgctgttggccaatcacggcctgcacatc
gaggtcttgatcgacccggaatcaccaataggcaagactgaccccgtcggcatcaaggat
gtgatcctggaatcggccatcaccacgatcatggacttcgaagactcagtcactgccgtc
gacgccgacgacaaggtacgcggctaccgcaactggctcggcctgaacaaaggtgactta
accgaggaagtcaacaaggacggcaagaccttcacccgcgtgctcaacgccgaccgcagc
tacaccacgcccgacggcggtgaattgaccctgcccgggcgcagcctgttgttcgtccgc
aacgtgggccatctgacgaccagcgacgcgattctcgtggacggaggtgacggtcaggaa
aaagaagtgttcgagggcatcatagatgcagtgttcaccggtctggccgcaatccacgga
ctcaaaaccggcgaagctaatggcccactgaccaacagccgcaccggttccatctacatc
gtcaagccgaaaatgcacggtcccgcggaggttgcgttcacttgcgagctgttcagccgc
gtcgaagacgtgctggggttgccgcagggcaccttgaaggtcggcatcatggatgaggag
cggcgtacgacactcaatttgaaggcgtgcatcaaggccgccgccgatcgggtcgtgttt
atcaacactggcttcttggaccgcaccggcgacgagatccacacctcaatggaggccggc
ccgatgattcgtaagggtgcgatgaaaaacagcacctggatcaaagcctacgaggacgcc
aatgttgacatcggactagccgcaggcttcaagggcaaagcacagatcggcaagggcatg
tgggcaatgaccgaattaatggctgatatggtcgagcagaagatcggccagcctaaggcg
ggcgccaccaccgcgtgggtaccctcgcccactgcggccacgctgcatgcgatgcactac
caccaggtcgacgtggctgccgtgcaacaagaactgaccggccagagacgtgccaccgtt
gaccagctgttgaccattccgttggccaaggaactggcctgggctcccgaggagatccgc
gaggaggtcgataatgactgtcagtccatcctcggttatgtggtgcgctgggtggaccag
ggtatcggttgctcgaaggtgcctgacatccacaatgtggcactaatggaggaccgcgcc
accctgcggatctcgagccagttgctagcaaactggctgcgccacggcgtaatcaccagc
gaggacgtgcgggccagcctggaacggatggcgccgttagtcgatcagcaaaacgccgaa
gacccagcatatcgcccgatggcgcctaatttcgatgacagcatcgcgttcctagcggcg
caggaactgatactgtccggcgcacaacagcccaacggctataccgagccgatcctgcat
cgccgtcgtcgcgaattcaaggcacagaaccggtga

DBGET integrated database retrieval system