KEGG   Mycobacterium leprae Br4923: MLBr_02441Help
Entry
MLBr_02441        CDS       T00842                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLBr_02441 (gpmA)
   01230 Biosynthesis of amino acids
    MLBr_02441 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLBr_02441 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MLBr_02441 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLBr_02441 (gpmA)
Enzymes [BR:mlb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MLBr_02441 (gpmA)
Exosome [BR:mlb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MLBr_02441 (gpmA)
  Exosomal proteins of melanoma cells
   MLBr_02441 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2916514..2917257)
Genome map
AA seq 247 aa AA seqDB search
MQQGNTATLILLRHGESDWNARNLFTGWVDVGLTDKGRAEAVRSGELLAEHNLLPDVLYT
SLLRRAITTAHLALDTADWLWIPVRRSWRLNERHYGALQGLDKAVTKARYGEERFMAWRR
SYDTPPPPIEKGSEFSQDADPRYTDIGGGPLTECLADVVTRFLPYFTDVIVPDLRTGRTV
LIVAHGNSLRALVKHLDEMSDDEVVGLNVPTGIPLRYDLDADLRPVVPGGTYLDPEAAAA
VISQARP
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagggtaacactgctacgctgattctactccgtcatggcgagagtgactggaat
gcccggaatctgttcaccggttgggtggacgtcgggctaaccgacaagggtcgagcggag
gcggtccgcagcggtgagttgcttgccgagcacaatctgttgcccgacgtgttgtacacg
tcgctgttgcgccgcgctatcaccactgcgcatctggcgttagacaccgccgactggcta
tggattccggtccgtcgcagctggcggctcaatgaacgtcactacggcgcgcttcagggt
ctggacaaggccgtgaccaaggcccgctacggcgaagaacgattcatggcttggcgccgc
agctacgacactccgccaccaccgatcgagaagggtagcgagttcagccaggatgctgac
cctcgctacaccgacattggcggcgggccgctgaccgaatgcctggctgatgtggtgacc
cgcttcctgccgtatttcaccgacgtgatagtccccgatctgcggaccggcagaacggtg
ctcattgtggcgcacggcaactcgctgcgcgcgctggtcaaacacctagacgagatgtcc
gacgacgaggtcgtcgggcttaacgttccgactggcattccgctgcgctatgatctagat
gccgatctgcgtccggtggtacccggtggtacctacctcgaccccgaggcggccgctgcg
gtaatcagtcaagcgcgcccgtaa

DBGET integrated database retrieval system