KEGG   Mycobacterium leprae Br4923: MLBr_02569Help
Entry
MLBr_02569        CDS       T00842                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MLBr_02569
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MLBr_02569
Enzymes [BR:mlb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MLBr_02569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3063826..3064989)
Genome map
AA seq 387 aa AA seqDB search
MAFPRTLIVLAAASALVVTCGHDVAQAPDSASIVAGELTAAALTPACVDLPASVPGTLST
RDKLAQLLMVGVRDAADAKAVVTDHHVGGIMIGSWTDLSMLINGALTDIARNPGPLPLAV
SVDEEGGRVSRLKSLIGMAPSARVLAQTSTVDQVYDMALDRGHKMRDLGITIDFAPVVDV
TDAPDDSVIGGRSFSSDPAVVTAYAGAYARGLRDAGVLPVLKHFPGHGHGSGDSHTGGVT
TPPLQDLQTNDLVPYRTLVADAPVGVMLGHLDVPGLTGDDPASLSPAAVQLLRTGANYGA
PPFNGPVFSDDVSSMAAISDRYGLADAVLRTLQAGTDIALWVSTQTVPAVLDRLEKVVSA
GELAMSAVDASVVRVATIKGPGPGCGR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccgcgcactctgattgtgcttgctgccgcctcggccctggtggtgacttgt
ggccacgatgttgcacaggctcctgactcggcgtcgatcgtagccggggagcttaccgcc
gccgcgctgacaccggcgtgcgtcgatctcccggcatctgtgccggggaccctgtccacc
cgcgacaagctggcccagctgctgatggtaggcgtacgtgatgcggccgatgccaaggcc
gttgtcaccgatcaccacgtcggcggcatcatgatcggcagctggacagacttgtcgatg
ttgatcaacggcgcgctgacagacatcgcccgcaatccgggaccgctgccgctggcggtc
agcgtcgatgaagaaggtggtcgggtgtcgcggttgaagtcgctgataggtatggcgcct
tcggctcgggtgctggcacagaccagcactgttgaccaggtctacgacatggcgctggac
cgtggtcacaagatgcgcgatttggggatcaccatcgatttcgccccagtcgtcgacgtg
accgacgccccggacgacagcgttatcggtggccgctcatttagctcggacccggccgtc
gttacagcctacgctggggcgtacgcgcggggtctgcgtgacgctggcgtgctgcctgta
ctcaaacattttcccggtcatgggcatggttcgggagattcgcacactggcggtgtcacc
acgccgccgctgcaagacctgcaaaccaacgacttggttccttaccggacgttggtggcc
gatgccccggtcggagtgatgctcggtcatctggacgttcccgggctgaccggtgacgac
ccagcgagtttgagccccgccgcggtgcagttgctgcgcactggcgctaactacggggcc
ccacctttcaatggtccggtctttagtgacgatgtgtccagcatggctgcgatttctgac
cgctacgggctggctgacgctgtgctacgcaccttgcaagctggcaccgacatcgcgctg
tgggtcagcacccagacagtgcctgcagtcttggaccggctagagaaggtggtatccgcg
ggcgaattagcgatgtcggccgtcgacgcttcagtcgtgcgggtagccaccataaaaggt
cccggcccggggtgcgggcgctag

DBGET integrated database retrieval system