KEGG   Mycoplasma leachii PG50: MSB_A0009Help
Entry
MSB_A0009         CDS       T01367                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mlc  Mycoplasma leachii PG50
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSB_A0009
DNA repair and recombination proteins [BR:mlc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MSB_A0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8081..8671
Genome map
AA seq 196 aa AA seqDB search
MPESIFNEIVESIRTNEGLTKKTSERLLVNLLLNKDKLNEFINQLNKVSQLISTCKICGY
LSENEKCLVCSLDNRNQNIICIVSTILDAKNIETANKYKGVYHILNGEINLNKNITFDKL
NISSIFKRVNDNTEIILALNSTFEGELTANYLYKLLSTKNVKITRLAKGMPMGASLDYMD
EFTLQSAFINRKKYGE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagtatatttaatgaaattgtagaatcaattagaactaatgagggattaact
aaaaaaacttcagaaagattattagtgaatttgttattaaataaagataaacttaatgaa
tttattaatcaactaaataaagttagccaactaatttcaacttgtaaaatatgtggatat
ttaagtgaaaatgagaaatgtttagtatgtagtttagataatagaaatcaaaatataatt
tgtatagtttcaacaattttagatgcaaaaaacatagaaactgcaaataagtataaagga
gtttatcatattttaaatggtgaaattaatctaaataaaaacattacatttgataagtta
aatattagttctatttttaaaagagttaatgacaatactgaaattattttagctttaaac
tctacttttgaaggcgaactaactgctaattatttatataaactactaagtactaaaaat
gttaaaatcacaagattagccaagggaatgccaatgggggctagtttagattatatggat
gaatttactttacaaagtgcatttattaatagaaaaaaatatggagaataa

DBGET integrated database retrieval system