KEGG   Mycoplasma leachii PG50: MSB_A0105Help
Entry
MSB_A0105         CDS       T01367                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSB_A0105
   00052 Galactose metabolism
    MSB_A0105
   00500 Starch and sucrose metabolism
    MSB_A0105
   00520 Amino sugar and nucleotide sugar metabolism
    MSB_A0105
Enzymes [BR:mlc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MSB_A0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
117428..118306
Genome map
AA seq 292 aa AA seqDB search
MKIRKAIIPCAGFGTRFLPFTKSQAKEMLPIIDKPAIEFIVQEAINSGIEEILIIIRAGK
NHIVNHFSRNIELEYFLTEKNKISELQLISEKYNATIYYLIQEEQLGLGHAISLAKDFIK
DEPFAVLLGDDLFKCKTPAIKQLIDIYDRYHQNVLGTIYIDKQNSKKYGICQGNQISEDV
YKVDLVVEKPEPENSPSNIAIGGRYVLLPEIFKYLDMKIKDKSGEIQLTDSILKTMDESE
CYAKIIDGSRYDIGNKLGYLDAILDFGLEREDLKEEFLDLIKTKVEKTSSNN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagccatcattccttgcgctggatttggtactagatttttacctttt
actaaatcacaagcaaaagaaatgctacctataatagataaacctgctatagaatttatt
gttcaagaagcaataaatagtggaattgaagaaattttaattataatacgtgctggaaaa
aatcacatagtcaaccattttagtagaaatattgaattagaatactttttaacagaaaaa
aataagataagtgaattacaactaataagtgaaaaatataacgcaacaatttattatcta
attcaagaagaacaacttggtttaggacatgctatttctttagcaaaagattttataaaa
gatgaaccatttgctgtgttgttaggtgatgatttatttaaatgtaaaaccccagctatt
aaacaattaatagatatttatgataggtatcatcaaaatgttcttggtactatttatatt
gataaacaaaatagtaaaaaatatggaatttgtcaaggtaatcaaatttcagaagatgtt
tataaagttgatttagttgttgaaaagccagaaccagaaaattctccaagtaatattgca
attggtggtagatatgttttattacctgaaatatttaaatatttagatatgaaaataaaa
gataaaagtggtgaaatccaactaactgattcaattttaaaaacaatggatgaatctgaa
tgttatgctaagataattgatggttcaagatatgatattggaaataaactaggttatctt
gatgctattttagattttggtttagaaagagaagatttgaaagaagagtttttagattta
ataaaaactaaagttgaaaaaacatcatcaaacaactag

DBGET integrated database retrieval system