KEGG   Mycoplasma leachii PG50: MSB_A0137Help
Entry
MSB_A0137         CDS       T01367                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSB_A0137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSB_A0137
   00052 Galactose metabolism
    MSB_A0137
   00500 Starch and sucrose metabolism
    MSB_A0137
   00520 Amino sugar and nucleotide sugar metabolism
    MSB_A0137
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSB_A0137
   00524 Butirosin and neomycin biosynthesis
    MSB_A0137
Enzymes [BR:mlc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MSB_A0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(152209..153174)
Genome map
AA seq 321 aa AA seqDB search
MKKILGVDLGGTSAKVGIISQNGDLEHSFSITNPKTKIIENLYFEIQKTLKTLNIDEKNI
MLVGITAPGFVDHNKGIVIMAPNIENGWFNYDLKTEAEFLFKKPVYVINDVNAAALGEYK
KGSGLVYKSGLFYWLGTGIGGAIISNGKLISGSHGFAGEFGHGGSNQYNLKCNCGLNNCI
EKVCSATTIPNSLLKILNNKYPEFYQKHFSNIKNLDMKLLFEIYNNLNKPIELKNSLLEV
YNELFNHMSLLIHALDPDVVIIGGGGSLAGNNLLEIFEFGVRNKLTNSYKDIVDFKLALL
KNDAGMIGAAFYALEQSLKAS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaggagtagatcttggtggaacttcagcaaaagttggaattatttca
caaaacggagatttagaacatagtttttctataactaatccaaaaactaaaattatagaa
aacttatattttgaaattcaaaaaactttaaaaacactaaacatagatgaaaaaaacatt
atgttagttggaataacagctcctggatttgttgatcataataagggaattgtaattatg
gctccaaatattgaaaatggatgatttaattatgatttaaaaactgaagctgaattttta
ttcaaaaaacctgtctatgtaattaatgatgtaaatgctgctgcacttggtgaatacaaa
aaaggatcaggactagtttataaatcaggtttattttattgattggggactggaattggt
ggagctataatttctaatggaaaactaatttcaggatcacatgggtttgctggagaattt
ggacacggtggaagtaatcaatacaatttaaaatgcaattgtggattaaataattgtatt
gaaaaagtatgttcagctacaactataccaaactcacttttaaaaattttaaataacaaa
tatcccgaattttatcaaaaacatttttcaaatattaaaaatttagatatgaaactttta
tttgaaatctataacaatttaaataaaccaatagagttaaaaaatagtttattagaagtt
tataatgaattattcaatcatatgtcattattaatacatgctttagatccagatgtagtt
attattggtggtggtggttctttagctggaaataatttattagaaatatttgaatttggt
gtaagaaataaattaacaaattcatataaagatatagttgattttaaattagctttatta
aaaaatgatgccggaatgatcggtgctgctttttatgctttagaacaatcactaaaagca
agttaa

DBGET integrated database retrieval system