KEGG   Mycoplasma leachii PG50: MSB_A0268Help
Entry
MSB_A0268         CDS       T01367                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSB_A0268 (pfkA)
   01230 Biosynthesis of amino acids
    MSB_A0268 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSB_A0268 (pfkA)
   00030 Pentose phosphate pathway
    MSB_A0268 (pfkA)
   00051 Fructose and mannose metabolism
    MSB_A0268 (pfkA)
   00052 Galactose metabolism
    MSB_A0268 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MSB_A0268 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MSB_A0268 (pfkA)
Enzymes [BR:mlc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MSB_A0268 (pfkA)
Protein phosphatases and associated proteins [BR:mlc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MSB_A0268 (pfkA)
Messenger RNA biogenesis [BR:mlc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MSB_A0268 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
312373..313353
Genome map
AA seq 326 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAIAGVVKTAASKGIEVYGINDGYKGLVNGWFEKLNVEKTLD
ILSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALVVIGGDGSYMGAQKLTEMGINC
IGLPGTIDNDISSTDYTIGFHTALNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTY
TAVATGAEIFSPAEDLLTIEQMGQKAKQFRLLGKKSLIILVSEKSYGISAEEIAEKIQKI
SGYETKATVLGHIQRGGRPTAMDRYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDID
STLNMKKEDKKPFIKYLREINGYFSK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaattggaattttgacttctggaggggatgctcctggaatgaataatgcc
attgctggagttgtaaaaacagcagcttcaaaaggaattgaagtatatgggattaatgat
gggtataaaggattagttaatggttgatttgaaaaactaaatgttgaaaaaactttagat
attctttcaagaggtggaacttatttaggatctgcaagattaccagaatttaaagaatta
gaagtaagacaaaaagcagtagctaatctaaaaaaggctggaattgaagctttagttgta
attggtggagatggtagttacatgggtgctcaaaaattaactgaaatgggcattaattgt
attggtttacctggaactattgataatgatatttcttcaactgattatactattggtttt
catactgcattaaatacaattgttgaagcagttgatagaattagagatacaatgcaatca
cacaatagagcagacgttgttgaaattatgggaaatggttgtggtgatttagtaacttat
actgcagttgctacaggagctgaaattttttcaccagctgaagatctactaacaattgaa
caaatgggtcaaaaagcaaaacaatttagattattaggtaaaaaaagtttaattatttta
gtttcagaaaaatcatatggaatttcagctgaagaaattgctgaaaaaattcaaaaaatt
agtggttatgaaactaaggcaactgttttaggacatattcaacgtggtggtagaccaact
gctatggatagatatattgcttttacagcaggtatgtttgctgttgaaaaattagctgaa
ggtaaaggtggattatttatcgggttagaaaataataaattagttgcaagagatattgat
tcaactttaaatatgaaaaaagaagataaaaaaccatttattaaatatttaagagaaatt
aatggatattttagtaaataa

DBGET integrated database retrieval system