KEGG   Mycoplasma leachii PG50: MSB_A0628Help
Entry
MSB_A0628         CDS       T01367                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mlc  Mycoplasma leachii PG50
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mlc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSB_A0628
Enzymes [BR:mlc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MSB_A0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(715147..715692)
Genome map
AA seq 181 aa AA seqDB search
MSNIKTEIKDYSKDRFKQEKLDENTELCIQINNSEYYQKDKVMYLRNENDLSNGDIGVIQ
KIHKDNNELKINFNDKIFSTINNASLKNLTLCYACTVHKTQGSEFEKVILVLDPKRSSSF
IDKKLIYTAITRARKQLVIIANKNSFINGINKNPETRDTTLVKHIKLMYKKRKKSHYSYI
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatataaaaacagaaataaaagattattcaaaagataggtttaaacaagaaaag
ttagatgaaaatactgaactatgtatacaaataaataatagtgaatattatcaaaaagat
aaagttatgtatttaagaaatgaaaatgatttatctaatggtgatattggagttattcaa
aaaatacataaagataataatgaactaaaaataaattttaatgataaaatcttttctaca
ataaacaatgcaagtcttaaaaatttaactttatgttatgcttgtacagttcataaaact
caaggtagtgaatttgaaaaagtaattttagttttagatcctaaaagaagcagttctttt
attgataagaaattaatctatactgctattactagagctagaaaacaattagtaattatt
gcaaataaaaactcttttattaatggaattaataaaaatcctgaaacaagagatacaaca
cttgttaaacatataaaacttatgtataaaaaaagaaagaagtctcattatagttatatc
ttttaa

DBGET integrated database retrieval system